PrisonPlanet Forum
May 19, 2013, 01:44:08 PM *
Welcome, Guest. Please login or register.

Login with username, password and session length
 
   Home   Help Login Register  
Pages: 1 ... 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 [44] 45 46 47   Go Down
  Print  
Author Topic: Understanding H5N1+H1N1 exposes eugenics plans of enemy CDC/WHO terrorists  (Read 219205 times)
EvadingGrid
Toxophillite
Global Moderator
Member
*****
Offline Offline

Posts: 10,616


Rat Catcher


WWW
« Reply #1720 on: May 04, 2009, 06:19:42 PM »

Yet how many "anti-war" liberals still cling to the fairy-tale notion that, by voting Democrat last year, they were voting "against" the imperialistic, parasitic, hornets' nest-stirring war machine that they complained so much about when the Republicans controlled everything?

More than a few perhaps?

I feel sorry for them, its only been about 100 days and he has behaved like a Bush clone
Logged

We few, we happy few, we band of brothers; For he today that sheds his blood with me, Shall be my brother;

Global Gulag
White Rose Sophie
Member
*****
Offline Offline

Posts: 1,985


« Reply #1721 on: May 04, 2009, 06:23:53 PM »

Yet how many "anti-war" liberals still cling to the fairy-tale notion that, by voting Democrat last year, they were voting "against" the imperialistic, parasitic, hornets' nest-stirring war machine that they complained so much about when the Republicans controlled everything?

More than a few perhaps?

I would hope so, but I doubt it.  People will BELIEVE what they want to believe....and they WANT to fault the previous administration for everything.  So they can go back to sleep.

Yes, this latest 'scare' is to give them cover for manufacturing the 'vaccine' that will kill millions.  And to keep people's mind off the other 'important' news.

 Angry
Logged
sociostudent
Guest
« Reply #1722 on: May 04, 2009, 08:05:26 PM »

Guys, this is so ridiculous, look at this:

Human-to-swine transmission escalates mutation risk
http://www.theglobeandmail.com/servlet/story/RTGAM.20090503.wflumain04/BNStory/National/home


ANDRÉ PICARD

From Monday's Globe and Mail

May 3, 2009 at 9:25 PM EDT

News that pigs contracted swine influenza A H1N1 virus from a human on a central Alberta farm should not alarm consumers of pork because the virus is not food-borne, food safety experts say.

But the unusual development creates a whole new series of challenges for public-health officials trying to limit the spread of the new form of flu in humans and swine alike.

“It happened once, it could happen again elsewhere,” said Peter Ben Embarek, a food-safety scientist at the World Health Organization.

As the virus jumps from pigs to humans and back again it risks mutating and becoming more dangerous to both species. And there is an added concern now that swine flu has been reported in parts of Asia where avian influenza is already present, and the pandemic strains could mix into a lethal cocktail.
“That is, of course, a concern and this is why it is necessary to monitor the situation closely,” Dr. Embarek said.

Yesterday, the WHO reported that there have been 937 confirmed cases of H1N1 flu in 18 countries.

Canada, for its part, has tallied 101 cases in seven provinces. Nova Scotia is hardest hit with 33 cases, most of them at King Edgehill school in the town of Windsor. Manitoba because the latest province hit by H1N1, also in a school-age child.

Officials in a number of countries warned that they expect a sharp increase in numbers in the coming days as laboratories catch up on the backlog of tests.

“I do expect more cases, more severe cases and more deaths,” Anne Schuchat, interim deputy director of the U.S. Centers for Disease Control and Prevention, said yesterday.

She noted that a clearer picture of who is at risk is beginning to emerge – and it is young adults who seem most vulnerable. About half the cases of H1N1 flu have been reported in people under 17, and half those over 17. That is markedly different from seasonal flu, which tends to hit young children and the elderly.

It is widely anticipated that, in coming days, the WHO will move the pandemic flu alert to phase 6, meaning the world is at risk of a full-blown pandemic.

“At the present time, I would still propose that a pandemic is imminent,” said Michael Ryan, director of the global alert and response team at WHO.

“At this point, we have to think stage 6 will be reached; we have to hope that it will not be reached.”

Others sounded more optimistic notes.

Mexico's Health Secretary, José Angel Cordova, said the worst was over and the H1N1 flu epidemic “is now in its declining phase.”

Canadian officials, for their part, were scrambling to deal with news of the virus hitting a pig farm in a country that exports $2.7-billion worth of pork products annually. While the immediate health risk posed by infected pigs is negligible, the optics are bad.

Brian Evans, chief veterinary officer at the Canadian Food Inspection Agency, said an investigation showed that a farm worker returned from Mexico on April 12 and had contact with pigs on the farm two days later. On April 24, pigs began showing signs of influenza; about 220 of the 2,200 pigs on the farm were found to be infected with H1N1. The farm, which CFIA refused to identify, was quarantined on April 28 and remains so even though the worker and all the pigs have recovered from the flu.

Three measures can be used to control outbreaks of disease in animals: Culling, vaccination and increased bio-security measures.

Dr. Evans said no cull was planned and no vaccine is yet available for the new strain of flu. The CFIA called on all veterinarians and pork producers to “increase their bio-security measures to limit any risks to animal health.”

There is no risk of contracting influenza from pork products. Flu viruses are fragile: They can survive only hours outside a live body – human or animal – and are easily destroyed in meat by cooking.

Dr. Schuchat of the CDC said that, in coming weeks, public-health officials are going to have to make some tough, unpopular decisions, such as deciding whether to close schools when there is an infected child, and deciding whether to proceed with large public gatherings like graduation ceremonies.

“At this time, cancelling public gatherings doesn't make sense,” she said.

One of the latest cases of H1N1 flu in Canada was detected at Collège Charlemagne, a private school in Montreal's west end. The school has no plans to close, even though the student, who contracted the illness on a visit to Mexico, seems to have attended school while ill with the flu.

David Butler-Jones, the Chief Public Health Officer of Canada, approved of that approach.

“Right now, we don't consider school closures to be necessary,” he said.




I don't know why they're so afraid of H1N1 being in swine, since they EXPERIMENTALLY INFECTED SWINE WITH THE 1918 PANDEMIC VIRUS back earlier THIS YEAR:
http://jvi.asm.org/cgi/content/abstract/JVI.02399-08v1
Experimental infection of pigs with the human 1918 pandemic influenza virus
Hana M. Weingartl*, Randy A. Albrecht, Kelly Lager, Shawn Babiuk, Peter Marszal, James Neufeld, Carissa Embury-Hyatt, Porntippa Lekcharoensuk, Terrence M. Tumpey, Adolfo García-Sastre, and Jürgen A. Richt*

National Centre for Foreign Animal Disease (NCFAD), Canadian Food Inspection Agency (CFIA), Winnipeg, Manitoba, Canada; Department of Medical Microbiology, Department of Immunology, University of Manitoba, Winnipeg, Manitoba, Canada; Department of Microbiology, Department of Medicine, Division of Infectious Diseases, and Emerging Pathogens Institute, Mount Sinai School of Medicine New York, USA; National Centre for Animal Disease, ARS-USDA, Ames, Iowa, USA; Centers for Disease Control and Prevention, Influenza Division, Atlanta, Georgia, USA; Kansas State University, College of Veterinary Medicine, Manhattan, Kansas, USA; Department of Microbiology ans Immunology, Faculty of Veterinary Medicine, Kasetsart University, Bangkok, Thailand

* To whom correspondence should be addressed. Email: hweingartl@inspection.gc.ca. jricht@vet.k-state.edu.


     Abstract

Swine influenza was first recognized as a disease entity during the 1918 "Spanish flu" pandemic. The aim of this work was to determine the virulence of a plasmid-derived human 1918 pandemic H1N1 (1918/rec) influenza virus in swine using a plasmid-derived A/swine/Iowa/15/1930 H1N1 virus (1930/rec), representing the first isolated influenza virus, as a reference. Four week old piglets were inoculated intratracheally with either the 1930/rec or the 1918/rec virus, or intranasally with the 1918/rec virus. A transient increase in temperature and mild respiratory signs developed post inoculation in all virus inoculated groups. In contrast to other mammalian hosts (mice, ferrets and macaques) where infection with the 1918/rec virus was lethal, the pigs did not develop severe respiratory distress or become moribund. Virus titers in the lower respiratory tract as well as macro- and microscopic lesions at 3 and 5 days post infection (dpi) were comparable between the 1930/rec and 1918/rec virus inoculated animals. In contrast to the 1930/rec infected animals, at 7 dpi, prominent lung lesions were present only in the 1918/rec infected animals, and all the piglets developed antibodies at 7 dpi.

Presented data support the hypothesis that the 1918 pandemic influenza was able to infect and replicate in swine causing a respiratory disease, and that the virus was likely introduced into the pig population during the 1918 pandemic resulting in the current lineage of the classical H1N1 swine influenza viruses.
Logged
Dig
All eyes are opened, or opening, to the rights of man.
Member
*****
Offline Offline

Posts: 63,103



WWW
« Reply #1723 on: May 04, 2009, 08:29:29 PM »

I don't know why they're so afraid of H1N1 being in swine, since they EXPERIMENTALLY INFECTED SWINE WITH THE 1918 PANDEMIC VIRUS back earlier THIS YEAR:
http://jvi.asm.org/cgi/content/abstract/JVI.02399-08v1
Experimental infection of pigs with the human 1918 pandemic influenza virus
Hana M. Weingartl*, Randy A. Albrecht, Kelly Lager, Shawn Babiuk, Peter Marszal, James Neufeld, Carissa Embury-Hyatt, Porntippa Lekcharoensuk, Terrence M. Tumpey, Adolfo García-Sastre, and Jürgen A. Richt*

National Centre for Foreign Animal Disease (NCFAD), Canadian Food Inspection Agency (CFIA), Winnipeg, Manitoba, Canada; Department of Medical Microbiology, Department of Immunology, University of Manitoba, Winnipeg, Manitoba, Canada; Department of Microbiology, Department of Medicine, Division of Infectious Diseases, and Emerging Pathogens Institute, Mount Sinai School of Medicine New York, USA; National Centre for Animal Disease, ARS-USDA, Ames, Iowa, USA; Centers for Disease Control and Prevention, Influenza Division, Atlanta, Georgia, USA; Kansas State University, College of Veterinary Medicine, Manhattan, Kansas, USA; Department of Microbiology ans Immunology, Faculty of Veterinary Medicine, Kasetsart University, Bangkok, Thailand

* To whom correspondence should be addressed. Email: hweingartl@inspection.gc.ca. jricht@vet.k-state.edu.


     Abstract

Swine influenza was first recognized as a disease entity during the 1918 "Spanish flu" pandemic. The aim of this work was to determine the virulence of a plasmid-derived human 1918 pandemic H1N1 (1918/rec) influenza virus in swine using a plasmid-derived A/swine/Iowa/15/1930 H1N1 virus (1930/rec), representing the first isolated influenza virus, as a reference. Four week old piglets were inoculated intratracheally with either the 1930/rec or the 1918/rec virus, or intranasally with the 1918/rec virus. A transient increase in temperature and mild respiratory signs developed post inoculation in all virus inoculated groups. In contrast to other mammalian hosts (mice, ferrets and macaques) where infection with the 1918/rec virus was lethal, the pigs did not develop severe respiratory distress or become moribund. Virus titers in the lower respiratory tract as well as macro- and microscopic lesions at 3 and 5 days post infection (dpi) were comparable between the 1930/rec and 1918/rec virus inoculated animals. In contrast to the 1930/rec infected animals, at 7 dpi, prominent lung lesions were present only in the 1918/rec infected animals, and all the piglets developed antibodies at 7 dpi.

Presented data support the hypothesis that the 1918 pandemic influenza was able to infect and replicate in swine causing a respiratory disease, and that the virus was likely introduced into the pig population during the 1918 pandemic resulting in the current lineage of the classical H1N1 swine influenza viruses.

Holy f**king shit!!!!!!!!!!!!!!!!!!!!

Please start a new thread with all the information on this.

Can anyone get the full studay and repost?

OMG!
Logged

All eyes are opened, or opening, to the rights of man. The general spread of the light of science has already laid open to every view the palpable truth, that the mass of mankind has not been born with saddles on their backs, nor a favored few booted and spurred, ready to ride them legitimately
trailhound
Member
*****
Offline Offline

Posts: 4,749



« Reply #1724 on: May 04, 2009, 08:38:04 PM »

http://jvi.asm.org/cgi/content/abstract/JVI.02399-08v1

 Shocked
Logged


"Do not let your hatred of a people incite you to aggression." Qur'an 5:2
At the heart of that Western freedom and democracy is the belief that the individual man, the child of God, is the touchstone of value..." -RFK
trailhound
Member
*****
Offline Offline

Posts: 4,749



« Reply #1725 on: May 04, 2009, 08:39:51 PM »

Full PDF here i think

http://jvi.asm.org/cgi/reprint/JVI.02399-08v1

Published in February this year. Says the virus caused a respiratory disease Roll Eyes
Logged


"Do not let your hatred of a people incite you to aggression." Qur'an 5:2
At the heart of that Western freedom and democracy is the belief that the individual man, the child of God, is the touchstone of value..." -RFK
Shadow911Zeus
Member
*****
Offline Offline

Posts: 635



« Reply #1726 on: May 04, 2009, 09:32:26 PM »

If you had a choice between Nano-silver type products or Oregano products, which one would you choose?
Logged
voodo0
Member
*****
Offline Offline

Posts: 1,097



« Reply #1727 on: May 04, 2009, 09:34:32 PM »

Nano-silver , that's just me.
Logged

TahoeBlue
Global Moderator
Member
*****
Online Online

Posts: 7,401


« Reply #1728 on: May 05, 2009, 10:58:21 AM »

Quote from: Sane date=1241490569
Holy f**king shit!!!!!!!!!!!!!!!!!!!!
Please start a new thread with all the information on this.
Can anyone get the full studay and repost? OMG!

Notice that this was just-in-time published!!!! Remember timing is everything..

http://jvi.asm.org/cgi/content/full/83/9/4287

Journal of Virology, May 2009, p. 4287-4296, Vol. 83, No. 9
0022-538X/09/$08.00+0     doi:10.1128/JVI.02399-08
Copyright © 2009, American Society for Microbiology. All Rights Reserved.

Received 19 November 2008/ Accepted 6 February 2009
...

Experimental Infection of Pigs with the Human 1918 Pandemic Influenza Virus

Logged
TahoeBlue
Global Moderator
Member
*****
Online Online

Posts: 7,401


« Reply #1729 on: May 05, 2009, 11:15:05 AM »

http://thedailybite.wordpress.com/2009/05/05/canadian-scientists-infect-pigs-with-deadly-zombie-virus-from-1918-spanish-h1n1-flu-pandemic/

Canadian scientists infect pigs with deadly Zombie virus from 1918 ‘Spanish’ H1N1 flu pandemic

May 5, 2009 ·
Hot off the Journal of Virology Press!!!

Experimental Infection of Pigs with the Human 1918 Pandemic Influenza Virus

“Swine influenza was first recognized as a disease entity during the 1918 “Spanish flu” pandemic. The aim of this work was to determine the virulence of a plasmid-derived human 1918 pandemic H1N1 influenza virus (reconstructed 1918, or 1918/rec, virus) in swine using a plasmid-derived A/swine/Iowa/15/1930 H1N1 virus (1930/rec virus), representing the first isolated influenza virus, as a reference. Four-week-old piglets were inoculated intratracheally with either the 1930/rec or the 1918/rec virus or intranasally with the 1918/rec virus. A transient increase in temperature and mild respiratory signs developed postinoculation in all virus-inoculated groups. In contrast to other mammalian hosts (mice, ferrets, and macaques) where infection with the 1918/rec virus was lethal, the pigs did not develop severe respiratory distress or become moribund.
….
Presented data support the hypothesis that the 1918 pandemic influenza virus was able to infect and replicate in swine, causing a respiratory disease, and that the virus was likely introduced into the pig population during the 1918 pandemic, resulting in the current lineage of the classical H1N1 swine influenza viruses.

Nostalgia has its place, but raising a lethal virus from the dead and infecting little piglets with it seems to take longing for the bad old days a bit far. Can’t blame Canada for the Zombie virus idea, though. The initial effort was led by a molecular pathologist at the Armed Forces Institute of Pathology in Rockville, Maryland. He and his team spent 10 years piecing together the deadly virus in a lab at the CDC in Atlanta.

They built their Zombie virus from pieces of wax-encased lung tissue that were preserved from the autopsies of two soldiers who were among the 1918 flu’s 675,000 American victims, and also from the frozen body of an Inuit woman buried in the Alaska permafrost after dying from the virus in November of 1918.

Oh, and we can’t blame the Spanish, either, for the 1918 ‘Spanish’ flu pandemic. The Irish Examiner reports about the real origin of that catastrophe here.

“Ryle would have us believe that all those American soldiers who died from non-combatant causes may have died from Spanish flu.

But US Army records show that seven men dropped dead after being vaccinated.

A report from US Secretary of War Henry L Stimson not only verified these deaths but also stated that there had been 63 deaths and 28,585 cases of hepatitis as a direct result of yellow fever vaccination during only six months of the war.

That was only one of the 14 to 25 shots given to recruits.

Army records also reveal that after vaccination became compulsory in the US Army in 1911, not only did typhoid increase rapidly but all other vaccinal diseases increased at an alarming rate.
…..
The army doctors knew all these cases of disease and death were due to vaccination and were honest enough to admit it in their medical reports.

When army doctors tried to suppress the symptoms of typhoid with a stronger vaccine, it caused a worse form of typhoid paratyphoid.   But when they concocted an even stronger vaccine to suppress that one, they created an even worse disease - Spanish flu.

After the war, this was one of the vaccines used to protect a panic-stricken world from the soldiers returning from WWI battlefronts infected with dangerous diseases.

Funny how a few short years after the Zombie virus was resurrected that a another mysterious new H1N1 virus has flashed around the globe. And some scientists have even said that this new virus is very similar to the Zombie virus.

According to the biodefense watchdog group, The Sunshine Project, the risk and suffering to experimental animals involved in recreating the 1918 virus are unjustified.  http://www.sunshine-project.org/

“(Austin and Hamburg, 9 October 2003) – The ‘Spanish Flu’ influenza virus that killed 20-40 million people in 1918 is currently under reconstruction. Several genes of the extraordinarily lethal 1918 flu virus have been isolated and introduced into contemporary flu strains. These proved to be lethal for mice, while virus constructs with genes from a current flu virus types had hardly any effect. These experiments may easily be abused for military purposes, but provide little benefit from a medical or public health point of view….”

Unfortunately you’ll note that the Sunshine Project is no longer shining its light on mistakes and accidental releases of deadly pathogens by biodefense research labs. Their work ended without explanation a few months after they reported a series of violations made by a lab in Texas. At least their website is archived for now.

Makes you wonder where this new ‘mutt’ H1N1 virus really originated, doesn’t it?

Well, main thing to remember is that if Canadian scientists are doing the cooking…

http://www.sunshine-project.org/

Quote
As of 1 February 2008, the Sunshine Project is suspending its operations.
Although this website is no longer updated, it remains online as an archive of our activities and publications from 2000 through 2008.
If you have any questions, please contact us by e-mail at tsp@sunshine-project.org.
Logged
sociostudent
Guest
« Reply #1730 on: May 05, 2009, 11:18:20 AM »

Did you write this?
Logged
trailhound
Member
*****
Offline Offline

Posts: 4,749



« Reply #1731 on: May 05, 2009, 11:26:22 AM »

Quote
Funny how a few short years after the Zombie virus was resurrected that a another mysterious new H1N1 virus has flashed around the globe. And some scientists have even said that this new virus is very similar to the Zombie virus.


 
 http://www.sciencedaily.com/releases/2009/04/090430111640.htm

1918 Flu Resulted In Current Lineage Of H1N1 Swine Influenza Viruses
ScienceDaily (May 1, 2009) — In 1918 a human influenza virus known as the Spanish flu spread through the central United States while a swine respiratory disease occurred concurrently. A Kansas State University researcher has found that the virus causing the pandemic was able to infect and replicate in pigs, but did not kill them, unlike in other mammalian hosts like monkeys, mice and ferrets where the infection has been lethal.


--------------------------------------------------------------------------------
See also:
 
Juergen A. Richt, Regents Distinguished Professor of Diagnostic Medicine and Pathobiology at K-State's College of Veterinary Medicine, studied the 1918 Spanish flu pandemic with colleagues from the Canadian Food Inspection Agency, U.S. Department of Agriculture and Mount Sinai School of Medicine.

Their research supports the hypothesis that the 1918 pandemic influenza virus and the virus causing the swine flu were the same. Richt said the virus was able to infect and replicate in swine and cause mild respiratory disease. The 1918 virus spread through the pig population, adapted to the swine and resulted in the current lineage of the H1N1 swine influenza viruses. The researchers' study is published in the May 2009 Journal of Virology.

"This study emphasizes that an influenza virus, which is known to induce a lethal infection in ferrets and macaques, is not highly virulent in pigs, indicating a potential resistance of swine to highly virulent influenza viruses," Richt said. "It also suggests that pigs could have played a role in maintaining and spreading the 1918 human pandemic influenza virus."

Swine flu is a respiratory disease of pigs caused by type A influenza that regularly causes outbreaks of influenza among the animals and can be transmitted to humans. It is a typical zoonotic agent. While swine flu was first recognized as a disease in 1918, there also were reports of the influenza occurring in the Midwest in 1930.

For the study, the researchers used the 1918 pandemic virus and a 1930 H1N1 influenza virus for experimental infections in swine. The 1930 virus was chosen as a virus because it is thought to be a descendent of the 1918 virus, Richt said.

The researchers did not find a significant difference in effects from the 1918 and 1930 viruses in infected pigs. This was surprising, since the 1918 virus killed more than 20 million people and was lethal to ferrets, mice and macaques. Another surprising finding from the study was the rapid antibody response in the animals infected with the 1918 virus, which is not typically reported for the swine influenza virus.

Richt said he plans to conduct a follow-up project that will study what makes a swine flu virus a pandemic flu virus.

The researchers conducted the study in the biosafety-level 4 laboratory and animal cubicle at the National Centre for Foreign Animal Disease in Canada.
 
Logged


"Do not let your hatred of a people incite you to aggression." Qur'an 5:2
At the heart of that Western freedom and democracy is the belief that the individual man, the child of God, is the touchstone of value..." -RFK
Brocke
Eleutherophiliac & Drapetomaniac
Global Moderator
Member
*****
Offline Offline

Posts: 9,403


I am not a number, I am a free man!


WWW
« Reply #1732 on: May 05, 2009, 02:43:12 PM »

http://thedailybite.wordpress.com/2009/05/05/canadian-scientists-infect-pigs-with-deadly-zombie-virus-from-1918-spanish-h1n1-flu-pandemic/

Canadian scientists infect pigs with deadly Zombie virus from 1918 ‘Spanish’ H1N1 flu pandemic...




Wow the Irish Examiner seems to be a font of information when it comes to this! Either they are really good and have been following the story OR they are the NWO/WHO propaganda conduit for this particular plot.

There are literally 500 articles in the Irish Examiner Archives on Spanish Flu! Everyone please go there and start reading, there may be much more information.


Irish Examiner Archives
http://archives.tcm.ie/search/index.asp

This man Patrick J Carroll who wrote letters/articles to the Irish Examiner would be interesting to talk to.

Patrick J Carroll,
Lady Lane House,
Waterford

Waterford Lifetime / Care of the Aged

Lady Lane House, Lady Lane, Waterford City
Tel: 051 874056
Website: N/A
Housing provided: Elderly




http://72.14.235.132/search?q=cache:vJ2m3uX2z4YJ:lyme.startpagina.nl/prikbord/read.php%3F1236,6096056,6096056+%22Spanish+flu%22+%22The+Irish+Examiner%22&cd=6&hl=en&ct=clnk

What homeopathic remedies were used to successfully treat the Spanish flu in 1918?
Gepost door: Pipo ()
Datum: 29 april 2009 10:52

(NaturalNews) Homeopathy was successful in treating the flu epidemic of 1918 and can provide answers to questions about the 2009 Swine Flu. Homeopathy can provide quick and inexpensive relief for symptoms of the flu. A system of medicine based on the principles of "like cures like," homeopathy uses plant, mineral and animal sources for the natural flu remedies. Homeopathy is based on ideas from ideas dating back to Egyptian medicine. The term "homeopathy" was coined by the medical doctor and medical reformer, Samuel Hahnemann in the 1800s. Homeopathic remedies have been used to treat flu symptoms for two centuries.

Was homeopathy successful in treating the flu epidemic of 1918?
Yes.
While the mortality rate of people treated with traditional medicine and drugs was 30 percent, those treated by homeopathic physicians had mortality rate of 1.05 percent.
Of the fifteen hundred cases reported at the Homeopathic Medical Society of the District of Columbia there were only fifteen deaths. Recoveries in the National Homeopathic Hospital were 100%. In Ohio, of 1,000 cases of influenza, Dr. T. A. McCann, MD, Dayton, Ohio reported NO DEATHS.

What homeopathic remedies were used to successfully treat the Spanish flu in 1918?
Gelsemium and Bryonia
According the Dr. Frank Wieland, MD, in Chicago, "(With) 8,000 workers we had only one death. Gelsemium was practically the only remedy used. We used no aspirin and no vaccines."

Homeopathy was 98% successful in treating the Spanish flu epidemic in 1918?
Yes.
Ohio reported that 24,000 cases of flu treated allopathically had a mortality rate of 28.2% while 26,000 cases of flu treated homeopathically had a mortality rate of 1.05% . In Connecticut, 6,602 cases were reported, with 55 deaths, less than 1%. Dr. Roberts, a physician on a troop ship during WWI, had 81 cases of flu on the way over to Europe. He reported, "All recovered and were landed. Every man received homeopathic treatment.

How do they know that a virus caused the flu epidemic of 1918, when the first virus was not isolated until 1933?
They don`t. In fact, many believe that the epidemic was actually a vaccine reaction.
When Army vaccinations became compulsory in 1911, the death rate from typhoid vaccination rose to the highest point in the history of the US Army. US Secretary of War Henry L Stimson reported that seven men dropped dead after being vaccinated. He also reported 63 deaths and 28,585 cases of hepatitis as a direct result of yellow fever vaccination during only six months of WW1. According to a report in the Irish Examiner, "The report of the Surgeon-General of the US Army shows that during 1917 there were admitted into the army hospitals 19,608 men suffering from anti-typhoid inoculation and vaccinia. When army doctors tried to suppress the symptoms of typhoid with a stronger vaccine, it caused a worse form of typhoid paratyphoid. But when they concocted an even stronger vaccine to suppress that one, they created an even worse disease Spanish flu."


Did the flu strain that caused the 1918 flu ever return?
Yes.
The 1918 `Spanish Flu` was first reported in an American military, Camp Funston, Fort Riley, in troops preparing for WW1 and receiving 25 vaccinations. According to the CDC, the same flu strain appeared only one other time: in 1976. This was again at a US army base, Fort Dix, and again, was seen in recently vaccinated troops, and only in them. The virus has not appeared anywhere else.

Is homeopathy successful in treating the modern flu?
Yes.

What can I do to prevent the flu?
Good food, clean living, rest and exercise are the basic ingredients.
There are certain nutrients that have been shown to help enhance the immune system, such as echinacea, vitamins C, E and beta carotene, zinc, and elderberries.



Irish Examiner Archives 08/05/03

Vaccine not virus responsible for Spanish flu

http://archives.tcm.ie/irishexaminer/2003/05/08/story265526733.asp

RYLE DWYER writes on the horror of the 1918-20 pandemic which the propaganda says was caused by Spanish flu (Irish Examiner, May 1, 2003).

How did they know it was the virus of Spanish flu that killed millions of civilians and soldiers?

This disaster occurred when viruses were unknown to medical science.

It took a British science team to identify the first virus in man in 1933.

As regards the origin of the outbreak, he relates that a senior US army officer suggested that the Germans might have been responsible for the bug as part of their war effort, by spreading it in theatres or where large numbers of people assembled.

Did they also spread it among their own people, killing 400,000 as reported?

Ryle would have us believe that all those American soldiers who died from non-combatant causes may have died from Spanish flu.

But US Army records show that seven men dropped dead after being vaccinated.

A report from US Secretary of War Henry L Stimson not only verified these deaths but also stated that there had been 63 deaths and 28,585 cases of hepatitis as a direct result of yellow fever vaccination during only six months of the war.

That was only one of the 14 to 25 shots given to recruits.

Army records also reveal that after vaccination became compulsory in the US Army in 1911, not only did typhoid increase rapidly but all other vaccinal diseases increased at an alarming rate.

After America entered the war in 1917, the death rate from typhoid vaccination rose to the highest point in the history of the US Army.

The deaths occurred after the shots were given in sanitary American hospitals and well-supervised army camps in France, where sanitation had been practised for years.

The report of the Surgeon-General of the US Army shows that during 1917 there were admitted into the army hospitals 19,608 men suffering from anti-typhoid inoculation and vaccinia.

This takes no account of those whose vaccine diseases were attributed to other causes.

The army doctors knew all these cases of disease and death were due to vaccination and were honest enough to admit it in their medical reports.

When army doctors tried to suppress the symptoms of typhoid with a stronger vaccine, it caused a worse form of typhoid paratyphoid.

But when they concocted an even stronger vaccine to suppress that one, they created an even worse disease Spanish flu.

After the war, this was one of the vaccines used to protect a panic-stricken world from the soldiers returning from WWI battlefronts infected with dangerous diseases.


The rest is history.

Patrick J Carroll,
Lady Lane House,
Waterford.



Irish Examiner Archives
Thursday, October 06, 2005 :

Scientists recreate Spanish flu to help understand bird virus

http://archives.tcm.ie/irishexaminer/2005/10/06/story135222155.asp

By Mike Stobbe, Atlanta
SCIENTISTS have made from scratch the Spanish flu virus that killed up to 50 million people in 1918, the first time an infectious agent behind a historic pandemic has been reconstructed. Why did they do it? Researchers say it may help them better understand - and develop defences against - the threat of a future worldwide epidemic from bird flu.

Like the 1918 virus, the avian flu in Southeast Asia occurs naturally in birds. In 1918, the virus mutated, infected people and then spread among them. So far, the current virus has killed at least 65 but has rarely spread person-to-person.

But viruses mutate rapidly and it could soon develop infectious properties like those seen in the 1918 bug, said Dr Jeffery Taubenberger of the US Armed Forces Institute of Pathology.

“The effort to understand what happened in 1918 has taken on a new urgency.”

Dr Taubenberger led the gene-sequencing team.

The public health risk of resurrecting the virus is minimal, health officials said. People worldwide developed immunity to the deadly 1918 virus after the pandemic, and a certain degree of immunity is believed to persist today. Also, previous research concluded modern antiviral medicines are effective against Spanish flu-like viruses.

The virus was made from scratch, but based on a blueprint from Alaska. A sample was taken from a flu victim buried in the permafrost there in 1918.

About 10 vials of virus were created, each containing 10 million infectious particles. The scientists said it only took days to cultivate the virus. 




Irish Examiner Archives
Monday, November 21, 2005 :

From Spanish flu to bird flu, someone stands to make a fortune

http://archives.tcm.ie/irishexaminer/2005/11/21/story692326615.asp

IT is now evident that bird flu has become synonymous with vaccination. What does that tell us about other scares in the past linked to vaccines? At the end of World War 1, newspapers orchestrated a warning that soldiers were returning from battlefields infected with dangerous diseases and everyone should avail of the life-saving jabs immediately. And that is what hysterical populations did, with the result that from 50-100 million died from the virulent viruses in the vaccines.

What newspapers omitted to tell their readers was that sufficient quantities had already been stockpiled to vaccinate the whole world, the scare having all too obviously been anticipated. Just like today’s bird flu.

That is what caused the pandemic of 1918-20, though history books tell us it was Spanish ‘flu.

One morning in the 1960s, British newspapers carried big headlines warning that a Pakistani immigrant was found to be infected with smallpox. Everybody was advised to get their jabs at once. Huge crowds lined up outside doctors’ surgeries and clinics. Shortly after the scare was over, TV newsreaders reported that around 100 people had died from the smallpox jab. This was the official figure, but the real number must have been a great deal more. I wrote to three Fleet Street editors and pointed out that smallpox was not contagious, and that the huge amount of vaccines stocked up suggested the scare had been anticipated. None of my letters was published.

About 25 years ago we had a rabies scare. French rabid foxes were said to be lining up to board ships bound for Britain and Ireland. When vaccine sales had reached saturation point, it was rumoured that the ‘rabid’ foxes had informed the vaccine firms they had changed their minds about emigrating. In 1994, the British Health Department launched a measles vaccine campaign against an epidemic the following year. Within a month, almost seven million children got measles booster jabs. Then hundreds of children suffered crippling disorders, including epilepsy, brain damage and many other afflictions.

Dr R Nicholson, editor of the Bulletin of Medical Ethics, had cause to protest... “there never was going to be a measles epidemic in 1995. The evidence showed clearly that the incidence of measles had been dropping over the decades.”

When he asked the Department of Health to produce the figures on which the prediction for the epidemic was based, they were unable to do so. So much for vaccine scaremongering.

Patrick J Carroll
Lady Lane House
Waterford



Irish Examiner Archives
Tuesday, November 08, 2005 :

‘No society will escape deadly flu pandemic’

http://archives.tcm.ie/irishexaminer/2005/11/08/story696412293.asp

A DEADLY new global pandemic of human influenza is inevitable and suffering will be “incalculable” unless the world is ready, the chief of the UN health agency said yesterday. The World Bank put the possible economic cost at a minimum of €675 billion.

"We have been experiencing a relentless spread of avian flu" among migratory birds and domestic poultry, Lee Jong-wook, director- general of the World Health Organisation, told a meeting of 600 health experts and planners, the first attempt to devise a global strategy in case the bird flu virus changes to transmit easily between humans.

Lee stressed that a human flu pandemic has yet to begin anywhere in the world. "However, the signs are clear that it is coming," he said, noting that a changed avian flu virus caused the deadly "Spanish" flu pandemic that killed tens of millions of people in 1918/19.

Already the virulent H5N1 strain of avian flu, which appeared in Hong Kong in 1997, is killing birds in 15 countries of Europe and Asia, he said.

"This is the time for every country to prepare their national action plan and act on it," Lee said. "If we are unprepared, the next pandemic will cause incalculable human misery both directly from the loss of human life and indirectly through its widespread impact on security. No society will be exempt. No economy would be left unscathed."

Estimates of the number of people who would die in a new pandemic have varied widely between two million and €360m, but WHO says a reasonable maximum would be €7.4m.

A senior World Bank economist said a pandemic could cause world gross domestic product to drop by 2% or more. That would amount to about €675 billion over the course of a year, said Milan Brahmbhatt.

Although bird flu has recurred over the years, scientists have been watching H5N1 since its impact on humans started to be noticed. In early 2004 officials announced that three people an adult and two children had died from the disease in Vietnam.

Since then, more than 120 people, most of whom were in close contact with poultry, have come down with the disease in Vietnam, Cambodia, Thailand and Indonesia, WHO says. More than half of the people infected have died.

More than 150 million chickens and other poultry have died or been culled, but that has not halted the spread of the disease to birds in central Asia, Russia and eastern Europe.

Samuel Jutzi of the United Nations Food and Agriculture Organisation said the cost to the economies of the affected countries from the poultry losses is estimated above €10 billion.

Around the world, governments have been making plans in case the virus mutates into one that easily transmits among people. Developing a vaccine is hampered because it is unknown exactly what form the deadly virus would take, so many governments are stocking up on antiviral drugs that work against regular flu and are believed to be the best immediate weapon to confront a pandemic until a vaccine can be produced.


Logged



That men do not learn very much from the lessons of history is the most important of all the lessons of history.
~Aldous Huxley
sociostudent
Guest
« Reply #1733 on: May 05, 2009, 04:18:43 PM »

http://archives.tcm.ie/irishexaminer/2005/10/06/story135222155.asp
Thursday, October 06, 2005 :

Scientists recreate Spanish flu to help understand bird virus

By Mike Stobbe, Atlanta
SCIENTISTS have made from scratch the Spanish flu virus that killed up to 50 million people in 1918, the first time an infectious agent behind a historic pandemic has been reconstructed.Why did they do it? Researchers say it may help them better understand - and develop defences against - the threat of a future worldwide epidemic from bird flu.

Like the 1918 virus, the avian flu in Southeast Asia occurs naturally in birds. In 1918, the virus mutated, infected people and then spread among them. So far, the current virus has killed at least 65 but has rarely spread person-to-person.

But viruses mutate rapidly and it could soon develop infectious properties like those seen in the 1918 bug, said Dr Jeffery Taubenberger of the US Armed Forces Institute of Pathology.

“The effort to understand what happened in 1918 has taken on a new urgency.”

Dr Taubenberger led the gene-sequencing team.

The public health risk of resurrecting the virus is minimal, health officials said. People worldwide developed immunity to the deadly 1918 virus after the pandemic, and a certain degree of immunity is believed to persist today. Also, previous research concluded modern antiviral medicines are effective against Spanish flu-like viruses.

The virus was made from scratch, but based on a blueprint from Alaska. A sample was taken from a flu victim buried in the permafrost there in 1918.

About 10 vials of virus were created, each containing 10 million infectious particles. The scientists said it only took days to cultivate the virus.
Logged
sociostudent
Guest
« Reply #1734 on: May 05, 2009, 04:32:29 PM »

I read the rest of their stuff, and everything else I found about the pandemic flu totally toes the party line, so maybe it slipped past the editor, lol.
Logged
TahoeBlue
Global Moderator
Member
*****
Online Online

Posts: 7,401


« Reply #1735 on: May 05, 2009, 05:06:54 PM »

I read the rest of their stuff, and everything else I found about the pandemic flu totally toes the party line, so maybe it slipped past the editor, lol.

CDC created this hybrid flu years ago--CDC/Baxter/Schering-Plough/Merck

Add to timeline : Oct 2004 - Reconstruction of 1918 Swine Flu

http://forum.prisonplanet.com/index.php?topic=101338.msg610759#msg610759
Human Error and Biosafety Laboratories

"The researchers working on the 1918 virus say their work is vital to understand what changes make flu viruses dangerous."

Or one could also say:

"The researchers working on the 1918 virus say their work is vital to understand HOW TO make flu viruses dangerous."

Several teams have added one or more of these genes to modern flu viruses, or plan to – in effect partially recreating the long-vanished pandemic virus.

The researchers also found that people born after 1918 have little or no immunity.

http://www.ace-ej.org/BiolabWeb/Biolabdocs/Klotztestimony.pdf

...
Logged
TahoeBlue
Global Moderator
Member
*****
Online Online

Posts: 7,401


« Reply #1736 on: May 05, 2009, 05:24:46 PM »

http://thedailybite.wordpress.com/2009/05/03/did-a-synthetic-peptide-pig-vaccine-trial-in-mexico-spawn-the-quadruply-reassorted-h1n1-swine-flu-virus-outbreak/

Did a synthetic peptide pig vaccine trial in Mexico spawn the quadruply reassorted H1N1 swine flu virus outbreak?
May 3, 2009 · No Comments

...
Which of the segments is a bird segment and which is humans wasn’t discussed in today’s briefing, but the fact that the genetic sources comprise widely different geographies and species is highly unusual….”

....

That does sound hard to explain as a result of the natural viral reassortments that pigs are believed to do, and there is nothing natural about the synthetic vaccines being tested on pigs in central Mexico in recent years. An article from 2005, Easy-To-Make Vaccine http://www.abc.net.au/ra/innovations/stories/s1302311.htm , covers the history and technology of these vaccines. A researcher interviewed states, “It’s been a long road, but the last five years I guess, everything’s started happening.”


Vaccine 2008 Jun 2;26(23):2899-905. Epub 2008 Apr 10:
http://www.ncbi.nlm.nih.gov/pubmed/18440675?ordinalpos=1&itool=EntrezSystem2.PEntrez.Pubmed.Pubmed_ResultsPanel.Pubmed_DiscoveryPanel.Pubmed_Discovery_RA&linkpos=4&log$=relatedarticles&logdbfrom=pubmed

“In search of reducing vaccine production costs’, a recombinant M13 phage version of the anti-cysticercosis tripeptide vaccine (S3Pvac) was developed. The efficacy of S3Pvac-Phage vs. placebo was evaluated in a randomized trial that included 1,047 rural pigs in 16 villages of Central Mexico. Three to five months after vaccination 530 pigs were examined by tongue inspection. At 5-27 months of age, 331 pigs (197 vaccinated/134 controls) were inspected at necropsy. Vaccination reduced 70% the frequency of tongue cysticercosis and, based on necropsy, 54% of muscle-cysticercosis and by 87% the number of cysticerci.”

Could it be possible that peptides used in that vaccine were incorporated into the mysterious new virus? Also, peptides are far from 100% pure.

Check purities and pricing for peptides here. That company also sells recombinant proteins and peptides for many species, so at purities ranging from 70-90 percent, I think we’ll be seeing more and more new forms of life created on this planet. And current ‘higher’ life forms, (as we like to think of ourselves), will have little or no immunity to these new ‘lower’ life forms

Don’t worry, a solution is at hand. Immune Targeting Systems (ITS) has received £4m (€5.9m) to aid in its development of synthetic peptide vaccines for mutating viruses such as influenza, HIV and Hepatitis C.
http://www.drugresearcher.com/Emerging-targets/ITS-a-winner-for-mutating-virus-vaccine-funding

But think twice before accepting a synthetic peptide vaccine. Synthetic peptide vaccines have had unexpected results in recent research.

Journal of General Virology (2002), 83, 1851-1859
http://vir.sgmjournals.org/cgi/content/full/83/8/1851

“Vaccination of pigs with a DNA construct expressing an influenza virus M2–nucleoprotein fusion protein exacerbates disease after challenge with influenza A virus“
Logged
nofakenews
Guest
« Reply #1737 on: May 05, 2009, 06:44:13 PM »

FDA outs swine flu frauds

The FDA has begun ferreting out the unapproved swine flu products out there on the market, and yesterday they started a webpage listing them. So far there are two unauthorized products listed by the same company, SilverCure’s Swine Flu Protection Kit, and Silver Shampoo.

We’re wary of any product that claims to "cure" or "prevent" swine flu, save the FDA-approved prescription drugs Tamiflu (oseltamivir) and Relenza (zanamivir), which should be used only under the supervision of a doctor. That includes most dietary supplements that claim to prevent or treat the flu, and especially those that contain silver, which can be dangerous.

See our full swine flu coverage for products that have solid evidence behind them to help you reduce the likelihood of transmission, including advice about when a mask can help and what kind to get, and what kind of disinfectants to use when someone is sick in your home.

If you see potential swine flu rip-offs, you can report them to the FDA.

—Kevin McCarthy, associate editor
http://blogs.consumerreports.org/health/2009/05/fda-outs-swine-flu-frauds-swine-flu-h1n1-news-dietary-supplements-silvercures-swine-flu-protection-k.html

http://www.accessdata.fda.gov/scripts/h1n1flu/

No colloidal silver...  Shocked
Logged
luckee1
Guest
« Reply #1738 on: May 05, 2009, 08:02:30 PM »

Of course the FDA and all the other alphabet organization will spout that.  They think tht on ly drugs will cure disease.  They are after job security and yet more control.
Logged
White Rose Sophie
Member
*****
Offline Offline

Posts: 1,985


« Reply #1739 on: May 05, 2009, 11:28:51 PM »

FDA outs swine flu frauds

The FDA has begun ferreting out the unapproved swine flu products out there on the market, and yesterday they started a webpage listing them. So far there are two unauthorized products listed by the same company, SilverCure’s Swine Flu Protection Kit, and Silver Shampoo.

We’re wary of any product that claims to "cure" or "prevent" swine flu, save the FDA-approved prescription drugs Tamiflu (oseltamivir) and Relenza (zanamivir), which should be used only under the supervision of a doctor. That includes most dietary supplements that claim to prevent or treat the flu, and especially those that contain silver, which can be dangerous.

See our full swine flu coverage for products that have solid evidence behind them to help you reduce the likelihood of transmission, including advice about when a mask can help and what kind to get, and what kind of disinfectants to use when someone is sick in your home.

If you see potential swine flu rip-offs, you can report them to the FDA.

—Kevin McCarthy, associate editor
http://blogs.consumerreports.org/health/2009/05/fda-outs-swine-flu-frauds-swine-flu-h1n1-news-dietary-supplements-silvercures-swine-flu-protection-k.html

http://www.accessdata.fda.gov/scripts/h1n1flu/

No colloidal silver...  Shocked

Now, you KNOW the stuff works if the FDA wants to get rid of it.   Cheesy Cheesy
Logged
sociostudent
Guest
« Reply #1740 on: May 06, 2009, 06:23:16 AM »

Here's the original strain isolated in Mexico. Weird thing is, it doesn't give an age or a gender for the "homo sapiens" who was unfortunate enough to contract 4 different flu viruses at once  Roll Eyes :

http://www.ncbi.nlm.nih.gov/genomes/FLU/SwineFlu.htmlhttp://www.ncbi.nlm.nih.gov/nuccore/FJ998206

Influenza A virus (A/Mexico/InDRE4487/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds

    * Comment
    * Features
    * Sequence

LOCUS       FJ998206                2308 bp    cRNA    linear   VRL 05-MAY-2009
DEFINITION  Influenza A virus (A/Mexico/InDRE4487/2009(H1N1)) segment 1
            polymerase PB2 (PB2) gene, complete cds.
ACCESSION   FJ998206
VERSION     FJ998206.1  GI:229484024
DBLINK      Project:37813
KEYWORDS    .
SOURCE      Influenza A virus (A/Mexico/InDRE4487/2009(H1N1))
  ORGANISM  Influenza A virus (A/Mexico/InDRE4487/2009(H1N1))
            Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
            Influenzavirus A.
REFERENCE   1  (bases 1 to 2308)
  AUTHORS   Bastien,N., Graham,M., Tyler,S., Vam Domselaar,G., Drebot,M.,
            Plummer,F., Aranda,C.A., Zavala,E.P. and Li,Y.
  CONSRTM   Unknown Pathogen Investigation Collaborative Team (UPICT) and
            Instituto de Diangnostico y Referencia Epidemiologicos (inDRE)
  TITLE     The Isolation and Characterization of the H1N1 Influenza A Strain
            (Swine) From Mexico, April 2009
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2308)
  AUTHORS   Bastien,N., Graham,M., Tyler,S., Vam Domselaar,G., Drebot,M.,
            Plummer,F., Aranda,C.A., Zavala,E.P. and Li,Y.
  CONSRTM   Unknown Pathogen Investigation Collaborative Team (UPICT) and
            Instituto de Diangnostico y Referencia Epidemiologicos (inDRE)
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2009) National Microbiology Laboratory, Public
            Health Agency of Canada, 1015 Arlington Street, Winnipeg, Manitoba
            R3E 3R2, Canada
COMMENT     GenBank Accession Numbers FJ998211, FJ998217, FJ998226, FJ998214,
            FJ998223, FJ998220, FJ998208, FJ998206 represent sequences from the
            8 segments of Influenza A virus (A/Mexico/InDRE4487/2009(H1N1)).
            Swine influenza A (H1N1) virus isolated during human swine flu
            outbreak of 2009.
FEATURES             Location/Qualifiers
     source          1..2308
                     /organism="Influenza A virus
                     (A/Mexico/InDRE4487/2009(H1N1))"
                     /mol_type="viral cRNA"
                     /strain="A/Mexico/InDRE4487/2009"
                     /serotype="H1N1"
                     /isolate="NML MX00010"
                     /host="Homo sapiens"
                     /db_xref="taxon:643780"
                     /segment="1"
                     /country="Mexico"
                     /collection_date="2009"
     gene            14..2293
                     /gene="PB2"
     CDS             14..2293
                     /gene="PB2"
                     /codon_start=1
                     /product="polymerase PB2"
                     /protein_id="ACQ73384.1"
                     /db_xref="GI:229484025"

                     /translation="MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPA
                     LRMKWMMAMRYPITADKRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRN
                     GPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQ
                     DVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFL
                     PVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADP
                     LASLLEMCHSTQIGGVRMVDILRQNPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTS
                     GSSVKKEEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQ
                     SIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG
                     IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDRFLRVRDQR
                     GNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTYQWIIRNWEIVKIQWSQ
                     DPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLFQQMRDVLGTFDTVQIIKLLPFAAA
                     PPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNKATKRLTVLGKDAGALTEDPDEG
                     TSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRD
                     SSILTDSQTATKRIRMAIN"
ORIGIN     
        1 aaatatattc aatatggaga gaataaaaga actgagagat ctaatgtcgc agtcccgcac
       61 tcgcgagata ctcactaaga ccactgtgga ccatatggcc ataatcaaaa agtacacatc
      121 aggaaggcaa gagaagaacc ccgcactcag aatgaagtgg atgatggcaa tgagataccc
      181 aattacagca gacaagagaa taatggacat gattccagag aggaatgaac aaggacaaac
      241 cctctggagc aaaacaagcg atgctggatc agaccgagtg atggtatcac ctctggccgt
      301 aacatggtgg aataggaatg gcccaacaac aagtacagtt cattacccta aggtatataa
      361 aacttatttc gaaaaggtcg aaaggttgaa acatggtacc ttcggccctg tccacttcag
      421 aaatcaagtt aaaataagga ggagagttga tacaaaccct ggccatgcag atctcagtgc
      481 caaggaggca caggatgtga ttatggaagt tgttttccca aatgaagtgg gggcaagaat
      541 actgacatca gagtcacagc tggcaataac aaaagagaag aaagaagagc tccaggattg
      601 taaaattgct cccttgatgg tggcgtacat gctagaaaga gaattggtcc gtaaaacaag
      661 gtttctccca gtagccggcg gaacaggcag tgtttatatt gaagtgttgc acttaaccca
      721 agggacgtgc tgggagcaga tgtacactcc aggaggagaa gtgagaaatg atgatgttga
      781 ccaaagtttg attatcgctg ctagaaacat agtaagaaga gcagcagtgt cagcagaccc
      841 attagcatct ctcttggaaa tgtgccacag cacacagatt ggaggagtaa ggatggtgga
      901 catccttaga cagaatccaa ctgaggaaca agccgtagac atatgcaagg cagcaatagg
      961 gttgaggatt agctcatctt tcagttttgg tgggttcact ttcaaaagga caagcggatc
     1021 atcagtcaag aaagaagaag aagtgctaac gggcaacctc caaacactga aaataagagt
     1081 acatgaaggg tatgaagaat tcacaatggt tgggagaaga gcaacagcta ttctcagaaa
     1141 ggcaaccagg agattgatcc agttgatagt aagcgggaga gacgagcagt caattgctga
     1201 ggcaataatt gtggccatgg tattctcaca agaggattgc atgatcaagg cagttagggg
     1261 cgatctgaac tttgtcaata gggcaaacca gcgactgaac cccatgcacc aactcttgag
     1321 gcatttccaa aaagatgcaa aagtgctttt ccagaactgg ggaattgaat ccatcgacaa
     1381 tgtgatggga atgatcggaa tactgcccga catgacccca agcacggaga tgtcgctgag
     1441 agggataaga gtcagcaaaa tgggagtaga tgaatactcc agcacggaga gagtggtagt
     1501 gagtattgac cgatttttaa gggttagaga tcaaagaggg aacgtactat tgtctcccga
     1561 agaagtcagt gaaacgcaag gaactgagaa gttgacaata acttattcgt catcaatgat
     1621 gtgggagatc aatggccctg agtcagtgct agtcaacact tatcaatgga taatcaggaa
     1681 ctgggaaatt gtgaaaattc aatggtcaca agatcccaca atgttataca acaaaatgga
     1741 atttgaacca tttcagtctc ttgtccctaa ggcaaccaga agccggtaca gtggattcgt
     1801 aaggacactg ttccagcaaa tgcgggatgt gcttgggaca tttgacactg tccaaataat
     1861 aaaacttctc ccctttgctg ctgctccacc agaacagagt aggatgcaat tttcctcatt
     1921 gactgtgaat gtgagaggat cagggttgag gatactggta agaggcaatt ctccagtatt
     1981 caattacaac aaggcaacca aacgacttac agttcttgga aaggatgcag gtgcattgac
     2041 tgaagatcca gatgaaggca catctggggt ggagtctgct gtcctgagag gatttctcat
     2101 tttgggcaaa gaagacaaga gatatggccc agcattaagc atcaatgaac tgagcaatct
     2161 tgcaaaagga gagaaggcta atgtgctaat tgggcaaggg gacgtagtgt tggtaatgaa
     2221 acgaaaacgg gactctagca tacttactga cagccagaca gcgaccaaaa gaattcggat
     2281 ggccatcaat tagtgtcgaa ttgtttaa

And it's not just a "better reporting" thing,'cause Canada's holding out on us, too: The Canadian sequence A/Canada-ON/RV1527/2009(H1N1) at http://www.ncbi.nlm.nih.gov/nuccore/FJ998205 also doesn't list any age or gender info.

But I think the rest of them do. And it's also not a "different country, different reporting" thing, since:
1. We're under the WHO now, right?
and
2. Here's one from Bavaria, Germany (A/Regensburg/Germany/01/2009(H1N1))
http://www.ncbi.nlm.nih.gov/nuccore/FJ984953
and
A/New York/18/2009(H1N1)
http://www.ncbi.nlm.nih.gov/nuccore/FJ984351


Also, can anyone help me figure out what the PB1 and PB2 genes mean again? They seem to be present in the strains that are affecting the epicenters of where the virus originally "cropped up" (Mexico, California, Texas, and New York), and I think I remember an article talking about it having to do with virulence.


Logged
sociostudent
Guest
« Reply #1741 on: May 06, 2009, 07:24:47 AM »

From June 2005:
Characterization of the 1918 influenza virus polymerase genes

http://www.nature.com/nature/journal/v437/n7060/abs/nature04230.html
Jeffery K. Taubenberger1, Ann H. Reid1,2, Raina M. Lourens1,2, Ruixue Wang1, Guozhong Jin1  &  Thomas G. Fanning1

   1. Department of Molecular Pathology, Armed Forces Institute of Pathology, Rockville, Maryland 20850, USA
   2. †Present addresses: Board on Life Sciences, The National Academies, 6th Floor, 500 Fifth Street N.W., Washington DC 20001, USA (A.H.R.); University of Iowa, Roy J. and Lucille A. Carver College of Medicine, 200 CMAB, Iowa City, Iowa 52242, USA (R.M.L.)

Correspondence to: Jeffery K. Taubenberger1 Correspondence and requests for materials should be addressed to J.K.T. (Email: taubenberger@afip.osd.mil).

Top of page

The influenza A viral heterotrimeric polymerase complex (PA, PB1, PB2) is known to be involved in many aspects of viral replication and to interact with host factors1, thereby having a role in host specificity2, 3. The polymerase protein sequences from the 1918 human influenza virus differ from avian consensus sequences at only a small number of amino acids, consistent with the hypothesis that they were derived from an avian source shortly before the pandemic. However, when compared to avian sequences, the nucleotide sequences of the 1918 polymerase genes have more synonymous differences than expected, suggesting evolutionary distance from known avian strains. Here we present sequence and phylogenetic analyses of the complete genome of the 1918 influenza virus4, 5, 6, 7, 8, and propose that the 1918 virus was not a reassortant virus (like those of the 1957 and 1968 pandemics9, 10), but more likely an entirely avian-like virus that adapted to humans. These data support prior phylogenetic studies suggesting that the 1918 virus was derived from an avian source11. A total of ten amino acid changes in the polymerase proteins consistently differentiate the 1918 and subsequent human influenza virus sequences from avian virus sequences. Notably, a number of the same changes have been found in recently circulating, highly pathogenic H5N1 viruses that have caused illness and death in humans and are feared to be the precursors of a new influenza pandemic. The sequence changes identified here may be important in the adaptation of influenza viruses to humans.
Logged
sociostudent
Guest
« Reply #1742 on: May 06, 2009, 09:11:06 PM »

Augusta, GA - Two Augusta military cases probable new flu 
 
"Two members of the military from Augusta are probable cases of novel influenza virus A H1N1 but it is unclear whether they are in the Augusta area or are currently stationed in Texas, a Georgia health official said Wednesday. 
 
They are among four new probable cases of the new virus; those cases have a more than 95 percent chance of being confirmed. 
 
The Centers for Disease Control and Prevention notified the state of the two cases Wednesday morning, said Dr. Susan Lance, senior director of the office of protection and safety for the Georgia Division of Public Health. Because the military appears to send all of its suspected cases to Texas for testing, it is unclear where the military members might be, Dr. Lance said. Georgia’s first confirmed case was a woman from Kentucky so she is counted by the CDC as a Kentucky case even though she was tested and diagnosed in Georgia, she said. 
 
“Just in that way, these two people are Georgia residents so they are going to be called Georgia cases,” Dr. Lance said. “But it’s unclear exactly where they resided and where they were actually ill.” They are simply listed as Augusta area residents, she said..." 
 
http://chronicle.augusta.com/stories/latest/lat_518892.shtml
Logged
sociostudent
Guest
« Reply #1743 on: May 06, 2009, 09:47:08 PM »

Second strain of flu may complicate picture (Canadian and mexican strains don't match)--They're claiming the seasonal flu strain mutated ALONG WITH this new flu.
http://www.alertnet.org/thenews/newsdesk/N06391128.htm
 06 May 2009 15:02:09 GMT
Source: Reuters
* Mutations seen in seasonal flu strain

* May have caused Canadian late-season outbreak

* May complicate picture in Mexico

By Maggie Fox, Health and Science Editor

WASHINGTON, May 6 (Reuters) - A second strain of influenza, one of the seasonal strains, may have mutated and may be complicating the picture in Mexico, Canadian researchers reported on Wednesday.

They have found a strain of the H3N2 virus that appears to have made a shift and could have complicated the flu picture in Mexico, epicenter of an outbreak of a new strain of the H1N1 swine flu virus.

One was seen in a traveler returning from Mexico, the team at the British Columbia Centre for Disease Control reported to Pro-MED, an online forum for infectious disease experts. And it may have been involved in an unusually late outbreak of flu in long-term care facilities this year.

The new H1N1 virus has killed at least 42 people in Mexico and two in the United States, has spread globally and brought the world to the brink of a pandemic. It appears to act like seasonal flu but doctors have been confused because it has also killed some young and apparently healthy adults -- not the usual pattern for influenza, which picks off the elderly, chronically ill and very young.

Danuta Skowronski and colleagues said they routinely sequence the hemagglutinin gene from a sample of influenza viruses submitted each season by community doctors, hospitals and care facilities across the province of British Columbia, Canada. Hemagglutinin gives a flu virus the "H" in its name, as in H1N1 or H3N2, and is found on the surface of the virus.

Vaccines target hemagglutinin and when it changes, the vaccine must be changed, too. This year the vaccine targets strains of H3N2 influenza, an H1N1 strain different from the new swine flu strain, and an influenza B strain.

"Until mid-February 2009, amino acid sequences of the hemagglutinin gene of H3 viruses in British Columbia were virtually identical to the vaccine strain," Skowronski wrote.

"In early March 2009, however, we detected additional differences from the vaccine strain among British Columbia viruses collected from facility outbreak settings." They only found these changes in flu samples taken from patients in care facilities.

When news broke of the new H1N1 strain, they ran more tests.

"We have sequenced the hemagglutinin gene of one of the H3 viruses from an ill traveler returning from Mexico and find it shares the same ... changes," they wrote.

"In British Columbia, these H3 mutations arose sometime in early March 2009 and we observe at least one returning traveler to have likely acquired illness due to this virus in Mexico," they wrote.

"We thus also wonder to what extent the profile of influenza-like illness initially reported from mid-March in Mexico may in part be attributed to this H3N2 variant in addition to emergence of the novel A/H1N1 virus."

(Reporting by Maggie Fox, Editing by Sandra Maler)
Logged
sociostudent
Guest
« Reply #1744 on: May 06, 2009, 09:53:26 PM »

Mexican president: 1st A/H1N1 flu cases in U.S. instead of Mexico
(Keep in mind, though, this is the same guy who claimed to have the vaccine ready 2 weeks ago, so idk if he's for real or not. Just take it for what it's worth)
http://news.xinhuanet.com/english/2009-05/07/content_11327820.htm

Special Report:  World Tackles A/H1N1 Flu        

    MEXICO CITY, May 6 (Xinhua) -- Mexican President Felipe Calderon said on Wednesday that the first A/H1N1 flu case had been found in the U.S. state of California instead of Mexico.

    "Let me tell you that technically, the first official record of the virus is swine flu A/H1N1 California 2009, reported in Imperial Valley in the state of California, in two children," Calderon said at a health center in Uruapan, a city in central Mexico.

    Imperial Valley borders the Mexican state of Baja California. The A/H1N1 flu has so far killed 42 and infected 1,070 more in Mexico after the first case was detected in the town of Perote on Mexico's Atlantic coast in March.

    Calderon thanked the Mexican people for applying measures to help check the virus.

    "The number of people infected grew geometrically in 10 days from April 17 to 27. That is to say, had it continued the way it was going, we would have had thousands more people infected and dozens more deaths," he said.

    Calderon said that the government had greatly expanded its capacity to check up to 700 samples a day and would continue boosting this capacity.

    A good deed for the outbreak is that it had helped the nation strengthen its health care infrastructure and made it better poised against similar crisis.

    "After this emergency, which I am sure we will overcome, Mexico will be ... stronger and more prepared" against other health threats, he said.

Logged
TahoeBlue
Global Moderator
Member
*****
Online Online

Posts: 7,401


« Reply #1745 on: May 07, 2009, 11:21:03 AM »

Search: synthetic virus

http://news.bbc.co.uk/1/hi/in_depth/sci_tech/2001/san_francisco/1181710.stm
Wednesday, 21 February, 2001, 04:15 GMT

Synthetic virus nearing reality

By BBC News Online's Jonathan Amos in San Francisco
Scientists will have the technology to create a wholly artificial virus within the next five years, a major conference in the US has been told.

The synthetic microbe could be used to help genetically engineer novel plants and animals, and treat human disease.

But if the technology is abused, it could lead to bioweapons against which society might have little defence.

The timetable for the creation of an artificial virus was laid out by Professor Clyde Hutchinson, of the University of North Carolina and The Institute of Genomic Research.

"This isn't trivial to do and no-one has yet reported doing it," he told the annual meeting of the American Association for the Advancement of Science (AAAS).

But he said: "If researchers put their minds to it, they could do it within a few years."

'Bad stuff'

Delegates to the annual meeting stressed that the issues surrounding a synthetic virus should not be over-dramatised.

Dr Jonathan Moreno, of the University of Virginia, and an author on bioweapons, said rogue states or groups already had access to plenty of destructive technologies

A synthetic virus is something to be concerned about, but the question is whether we could develop anything that is worse than what is already available in nature, that some have attempted to exploit for the purposes of bioweaponry - such as anthrax," he said.

"There's enough bad stuff out there now. So far, there is no reason to believe that this technology is going to make things any worse."

Professor Hutchinson and his fellow researchers are engaged in what is known as the Minimal Genome Project, which is investigating the smallest number of genes required to sustain life.

From scratch

The project may eventually provide the knowledge to create an artificial lifeform - most probably a small bacterium.

Such a lifeform would be built from scratch using fundamental chemicals and could be engineered to manufacture useful drug components or to break down chemicals at the site of a toxic spill.

But Prof Hutchinson told the AAAS synthetic lifeforms were still science fiction because of the difficulties in synthesising long segments of nucleic acid - the "life molecule" DNA and its chemical cousin RNA.

Most researchers would not regard a virus as being "alive", as it depends on the machinery of a living, host cell to replicate.

But its very much simpler design - nucleic acids perhaps just 10 kilobases in length and a few associated proteins - makes it an easier target for synthesis.

Although viruses are popularly seen as merely agents of disease, they also have a productive role in biotechnology.

Modified versions of viruses, in which the disease-causing elements have been "switched off", can be used to carry useful genes into an organism.

Design flexibility

Viruses could be important tools in future gene therapy, carrying genes into the cells of sick people to correct or replace the ones that have gone wrong.

A synthetic virus might make this task easier by providing greater flexibility of design.

The fear would be that the same technology could be used to synthesise a super-pathogen, or "biobomb", to terrorise society.

But Dr David Magnus, of the University of Pennsylvania Center for Bioethics, said any minded individual would probably opt for a simpler approach.

He said: "You don't have to synthesise a genome from scratch to be able to make a version of smallpox.

"You could get a close relative and use standard genetic engineering. You could probably do that right now."

Professor Daniel McGee, of Baylor University, said the threat always had to be judged against the benefits, with regulation steering us on the right course.

"We're toolmakers. The first axe could have been used for agricultural purposes and good purposes, or it could have been used for killing.

"The moral dilemma is essentially the same.

"The fact that there is more power now - it extends further than just one person with one axe - is significant, but it doesn't change the qualitative dimension of the moral dilemma."

Prof Hutchinson added: "Am I worried about a synthesised virus? No, you only worry about it if someone does it out of malicious motives."

http://news.bbc.co.uk/1/hi/sci/tech/2122619.stm
Thursday, 11 July, 2002, 23:28 GMT 00:28 UK

First synthetic virus created

Scientists have assembled the first synthetic virus.
The US researchers built the infectious agent from scratch using the genome sequence for polio.

Scientists are divided about whether a virus is alive. For those that think it is, then this synthetic artefact would constitute a simple form of life.

Responding to criticisms that such research could lead to bioterrorists engineering new lethal viruses, the scientists behind the experiment said that only a few people had the knowledge to make it happen.

'New reality'

To construct the virus, the researchers say they followed a recipe they downloaded from the internet and used gene sequences from a mail-order supplier.


Having constructed the virus, which appears to be identical to its natural counterpart, the researchers, from the University of New York at Stony Brook, injected it into mice to demonstrate that it was active.

The animals were paralysed and then died.


"The reason we did it was to prove that it can be done and it now is a reality," said Dr Eckard Wimmer, leader of the biomedical research team and co-author of the study published in the journal Science.

"This approach has been talked about, but people didn't take it seriously," said Dr Wimmer.

"Now people have to take it seriously. Progress in biomedical research has its benefits and it has its down side. There is a danger inherent to progress in sciences. This is a new reality, a new consideration."

'Very easy to do'

According to researcher Jeronimo Cello, the polio virus assembled in the laboratory is one of the simplest known viruses. "It was very easy to do," he said.

The more dangerous smallpox virus would be complex and difficult to assemble, but Cello says, "it would probably in the future be possible".

Dr Wimmer added: "The world had better be prepared."

Smallpox has been eradicated in the wild, but specimens are stored in the United States and in Russia.

Dr Wimmer said assembling the polio virus showed that eradicating a virus in the wild might not mean it was gone forever because biochemists could now reconstruct those viruses from blueprints.

Following last year's terrorist and anthrax-by-mail attacks, US officials became concerned about the threat of smallpox and arranged for the manufacture of enough vaccine to protect the US population.

Matter of time

Dr CJ Peters, director for the Center for Biodefense at the University of Texas Medical Center at Galveston, said experts had known for years that it was theoretically possible to assemble a virus in the lab.

This is a new reality
 
Dr Eckard Wimmer 
"We've known this could be done. We've known it was just a matter of time before it was done," he said.


Dr Peters said he was concerned that publicity about a synthesized virus might lead some people to believe "that there is nothing that can be done about bioterrorism - which is not the case".

He added that it was possible that viruses like Ebola could be assembled in laboratories, but there were only a few people in the world with that skill.

Polio is on the brink of being eradicated worldwide and there are plans to stop inoculations against the disease after it disappears from nature.

Dr Wimmer said that this policy should be reconsidered. Stopping vaccination could lead to a generation of people highly susceptible to polio, enhancing its appeal as a weapon.

The World Health Organization is planning to stockpile vaccines against a return of polio and Dr Wimmer said that policy should be followed everywhere.

http://www.eurekalert.org/pub_releases/2008-11/vumc-svs112508.php

Public release date: 25-Nov-2008

Synthetic virus supports a bat origin for SARS

Studies establish response strategy for emerging infections

SARS – severe acute respiratory syndrome – alarmed the world five years ago as the first global pandemic of the 21st century. The coronavirus (SARS-CoV) that sickened more than 8,000 people – and killed nearly 800 of them – may have originated in bats, but the actual animal source is not known.

In an effort to understand how SARS-CoV may have jumped from bats to humans, a team of investigators from Vanderbilt University Medical Center and the University of North Carolina at Chapel Hill has now generated a synthetic SARS-like bat coronavirus. The virus – the largest replicating synthetic organism ever made – is infectious in cultured cells and mice, the researchers report in the Proceedings of the National Academy of Sciences.

The findings identify pathways by which a bat coronavirus may have adapted to infect humans. The studies also provide a model approach for rapid identification, analysis and public health responses to future natural or intentional virus epidemics.

Zoonotic viruses – animal pathogens that can cause disease in humans – pose a serious threat to public health, said Mark Denison, M.D., professor of Pediatrics at Vanderbilt and a co-leader of the research with Ralph Baric, Ph.D., professor of Epidemiology at UNC.

"It's becoming more and more clear that new human epidemics will continue to originate in animals," said Denison, who is also an associate professor of Microbiology & Immunology. "However, the mechanisms of trans-species movement and adaptation of viruses from animals to humans remain poorly understood."

At the time of the SARS epidemic, the culprit virus was rapidly identified as a coronavirus (SARS-CoV). But it didn't look like the two human coronaviruses that were known, which cause 20 percent to 30 percent of common colds, and the animal "reservoir" (the original animal host for the virus) remained elusive.

Investigators became convinced that bats were the likely source, but bat coronaviruses had never been successfully grown in culture or animals, which blocked studies of replication, evolution and prevention.

The Denison and Baric teams, with lead authors Michelle Becker, Ph.D., of Vanderbilt, and Rachel Graham Ph.D., of UNC, determined that not being able to grow the virus represented a critical gap in the ability to rapidly identify and respond to new pathogens.

To address this vulnerability, the team decided to use synthetic biology to recover a non-cultivatable virus.

"The idea is, here's the virus, or the virus group, that we think became SARS-CoV," Denison said. "Let's see if we can synthetically recover the bat virus and test it in cultured cells and in animal models – let the bat virus show us the pathways that it may have used to become a human pathogen.

"Then we would have a viable candidate virus to test for diagnostics, vaccines and treatment."

The investigators used published SARS-like bat coronavirus sequences to establish a "consensus" genome sequence – "the best bet for a virus genome that would be viable," Denison said. They then used commercial DNA synthesis and reverse genetics to "build" the consensus viral genome and several variations.

The consensus synthetic SARS-like bat CoV did not initially grow in culture. But substitution of a single small region from human SARS-CoV – the Spike protein receptor binding domain that is critical for viral entry into human cells – allowed the new chimeric SARS-like bat CoV to grow well in monkey cells (commonly used to study human SARS-CoV).

"It was a tremendous surprise that such a small region of SARS-CoV was sufficient to allow the bat virus to move from zero growth to very efficient growth in cells," Denison said.

The chimeric virus also grew well in mouse cells modified to express the receptor for SARS-CoV and in primary human airway epithelial cells. It grew poorly in mice, but a single additional change in the Spike region allowed efficient growth in mice, without causing a SARS-like disease.

The studies suggest that a very simple recombination event may have been enough to allow a coronavirus to move from one species to another, Denison said, adding that "after a virus gains the capacity to jump species, additional simple adaptations may be adequate to increase its ability to grow in the new animal host."

At all stages of design and implementation, the Vanderbilt and UNC teams acknowledged potential safety concerns and encouraged ongoing external safety reviews. Research with all bat viruses – even weakened mutants – was performed under the same stringent biosafety conditions used to study virulent SARS-CoV. The investigators found that human antibodies known to render SARS-CoV noninfectious also neutralized the bat SARS-like coronavirus, providing an additional safety measure.

"The approaches used here address fundamental questions in virus movement between species," Denison said, "and also could improve public health preparedness by allowing rapid responses to naturally emerging or intentionally introduced zoonotic pathogens."

Gee and now there is a strange Bat disease problem Humm....


http://redgreenandblue.org/2009/05/05/white-nose-syndrome-spreads-through-usa-bat-population/

White Nose Syndrome Spreads Through USA Bat Population
Written by Kay Sexton
 
Published on May 5th, 2009

Since 2006 an epidemic has been traveling across America, and it’s not swine flu. So called White Nose Syndrome was first identified in caves near Albany, New York, three years ago.  Since then it has spread across the northeast United States and has recently been identified in six more caves in Virginia.

The tell-tale white marking of the muzzles and ears of the bats may not even be the cause of the bat mortality—although 99% of affected bats die, and are found to have the fungal infestation—it still isn’t clear if the fungus causes the deaths or is simply an opportunist infestation of already ill animals.

Bat deaths cause insect populations to spiral
Little Brown Bat populations have had the highest mortality rate, but Eastern Pipistrelles and Northern Long-Eared Bats have also been affected and it’s not simply a question of bats dying. The effects on the ecosystem as a whole may be profound because less bats means more insects, as bats are the highest consumers of nocturnal insect life around and without them predating on local insect populations, both households and farmers may find that pest species become rampant.

This is likely to mean increased use of insecticides on crops and that economic and environmental cost will be carried by the consumer in the end.  Two species of endangered bats live in the region where the WNS has been discovered in the past month. These are Indiana Bats and Virginia Big Eared Bats. The latter has a densely populated cave system less than five miles from one of the caves where WNS has just been found.

An epidemic without a clear cause or cure

It’s still not clear what is killing the bat populations, but what is known is that bats with WNS wake up more frequently from their winter hibernation which means they use up their fat stores, forcing them to leave the caves to seek food before the insect populations are around so that they simply starve to death. It’s also unclear how WNS spreads: some experts think it travels from bat to bat, while others suggest that disoriented and weakened bats may simply seek out the nearest cave after leaving their home community, thereby transmitting the disease or condition to a new bat colony, but others believe that humans who move from cave to cave may be transmitting the infection on their clothing and equipment. As a result, caves where WNS has been confirmed are ruled off limits to recreational cavers although there is on system in place to police the warning signs placed outside caves.

Like bees, bats are dying from unknown causes
There are interesting, and worrying, parallels with the Colony Collapse Disorder being experienced by bees: in that nobody knows the exact cause, the means of transmission or what the effect of this population loss will be on the wider environment.

There are a few reasons for optimism. First, WNS is not known to directly affect humans and second, researchers have discovered that providing a heat source to bats infected with WNS may help them conserve their body heat better, meaning that they although they wake, they return to sleep when near the heat, which might be a way of keeping some infected populations alive next winter, while a definitive cure or treatment is still being sought.
Logged
Sheepleprod
Member
*****
Offline Offline

Posts: 744



« Reply #1746 on: May 07, 2009, 11:40:41 AM »

Depending on who you ask, the Obama administration’s controversial pick to be the Department of Homeland Security’s geek-in-chief is either a leading authority on the deadliest terror threats — or a biowar chicken little, dangerously out of touch with reality.

At first glance, Dr. Tara O’Toole is a dream candidate to take over the position of DHS under secretary for science and technology. She’s a doctor, the CEO of the University of Pittburgh’s Center for Biosecurity, the chairwoman of the Federation of American Scientists, and the brains behind a series of influential disaster response exercises that woke Washington up to the threat of terrorists with weapons of massive destruction. Who better to take over DHS’ nearly billion-dollar research portfolio — about 45 percent of which goes towards chemical and biological defense?

But the outcry over O’Toole’s nomination began just moments after the White House announced its intent late Tuesday to name her to the job. To her critics, O’Toole has dangerously overhyped the bioterror threat — leading to a huge increase of the number of research labs and researchers handling deadly agents. Ironically, it’s these very facilities that are now these most likely sources for a deadly outbreak or bioattack; the 2001 anthrax strikes, for instance, were an inside job.

“This is a disastrous nomination. O’Toole supported every flawed decision and counterproductive policy on biodefense, biosafety, and biosecurity during the Bush Administration,” Rutgers University microbiologist and homeland security policy critic Richard Ebright tells Danger Room. “O’Toole is as out of touch with reality, and as paranoiac, as former Vice President Cheney. It would be hard to think of a person less well suited for the position.”

“She was the single most extreme person, either in or out of government, advocating for a massive biodefense expansion and relaxation of provisions for safety and security,” he adds. “She makes Dr. Strangelove look sane.”

O’Toole rose to prominence in biodefense circles after producing Dark Winter, a June 2001 exercise that explored how a single smallpox outbreak could threaten millions of lives in 15 countries. An Army War College report later found that the exercise tripled the normal transmission rate for smallpox — “mak[ing] it next to impossible for the game players to do very much to contain the outbreak, and assur[ing] a disastrous outcome irrespective of whatever control measures the players may attempt to carry out.” Atlantic Storm, a 2005 exercise also produced by O’Toole, had similar issues. According to the report, it made “grossly misleading assumptions” about the ease of creation and dispersion of the same biological agent — assuming bioterrorists would enjoy a capability that neither the Americans nor Soviets could achieve at the heights of the Cold War.
To George Smith, a protein chemist and senior fellow at GlobalSecurity.org, these exercsies show O’Toole to be “the top academic/salesperson for the coming of apocalyptic bioterrorism which has never quite arrived. [She's] most prominent for always lobbying for more money for biodefense, conducting tabletop exercises on bioterrorism for easily overawed public officials, exercises tweaked to be horrifying. [And she] has never obviously appeared to examine what current terrorist capabilities have been… in favor of extrapolating how easy it would be to launch bioterror attacks if one had potentially unlimited resources and scientific know-how.”It’s a “superb appointment if you’re in the biodefense industry and interested in further opportunity and growth,” he tells Danger Room. “Alternatively, a disaster if threat assessment and prevention ought to have some basis in reality.”

If confirmed, O’Toole would succeed the widely-respected Jay Cohen, a retired admira
Logged
bigron
Member
*****
Offline Offline

Posts: 22,124


RON PAUL FOR PRESIDENT 2012


« Reply #1747 on: May 07, 2009, 12:22:32 PM »

Flying Pigs and the WHO

Flying Pigs, Tamiflu and Factory Farms Part II:



By F. William Engdahl
http://www.globalresearch.ca/index.php?context=va&aid=13480
Global Research, May 4, 2009


WHO takes a page from a Michael Crichton Novel

 

As the late great American poet Yogi Berra might have put it, ‘this just gets absurder and absurder.’ The international agencies supposedly responsible for monitoring worldwide dangers of new pandemic threats, the WHO and CDC are acting like the directors of a Hollywood ‘B’ grade sci-fi movie or the author of a copycat version of Michael Crichton’s Andromeda Strain novel. The global panic over outbreak of a new human-to-human Swine Flu pandemic is increasingly revealed as a likely operation in mass psychological terror whose only beneficiaries are the few global pharmaceutical giants that are in the business of peddling so-called ‘antiviral’ drugs—Roche, SmithKlineGlaxo and Novavax most prominently. The losers are the rest of us normal folks.

 

The own releases of the WHO in Geneva and the US Centers for Disease Control in Atlanta, the central coordinating agencies in this production, are worth careful study. On April 30 the CDC issued a detailed report with the alarming title, Swine-Origin Influenza A (H1N1) Virus Infections in a School --- New York City. The report described in detail a school in New York City where, ‘As of April 28, approximately half (45) of all U.S. cases of S-OIV infection had been confirmed among students and staff members.’ The CDC called these cases all ‘genetically similar to viruses subsequently isolated from patients in Mexico.’1 We are not told in scientific terms what ‘genetically similar to’ means, but it sure sounds ominous.

 

At that point, the CDC claimed 109 victims of confirmed Swine Flu in the United States. Forty five of the 109 came from this New York School. The TV news channels were flooded with panic messages of the uncontrolled spread of Swine Flu.

 

On April 29, the next day, the WHO Director-General, Dr Margaret Chan, upgraded their Swine Flu Pandemic alert status from a Phase 4 event to Phase 5, a step below full global Pandemic Alert.

 

According to WHO, Phase 5 indicates that there is evidence of the virus being spread from human-to-human in at least two countries in one WHO region. Phase 6, the pandemic phase, is characterised by increased and sustained transmission in the general population. In her announcement of the upgrade, Dr Chan made an unfortunate panic-making added comment that was predictably grabbed onto by CNN and the world media: ‘After all it really is all of humanity that is under threat during a pandemic.’2 Note the WHO Director-General had not declared a Pandemic Phase 6 alert, but in a speech in Geneva in an apparent side comment, merely made the self-evident observation that ‘during a pandemic’ all humanity is under threat.’ 

 

A press release by the Atlanta-based CDC stated, ‘On May 3, CDC is scheduled to complete deployment of 25 percent of the supplies in the Strategic National Stockpile (SNS) to all states in the continental United States. These supplies and medicines will help states and US territories respond to the outbreak. In addition, the Federal Government and manufacturers have begun the process of developing a vaccine against the novel H1N1 flu virus.’3 The pandemic response apparatus was going into high gear.

 

The 45 New York City school children the CDC solemnly reported were ‘confirmed cases of swine-origin influenza A (H1N1) virus (S-OIV) infection,’ ninety-five percent of whom reported to the health authorities symptoms that included ‘fever plus cough and/or sore throat, meeting the CDC definition for influenza-like illness (ILI).’

 

OK. Better to be cautious when dealing with a new form of Andromeda Strain. But cough? Sore throat? Fever? Aren’t these pretty vague ordinary symptoms? Not for CDC apparently. The 45 kids were immediately added to the growing ‘confirmed cases’ statistics, fuelling emergency responses, statements by the President of the United States, economic catastrophe to the fragile Mexican economy as tourism dried up overnight, and worldwide fears of a new Black Death or at least a new version of the 1918 Spanish Flu plague.

 

The CDC hastened to add the note, ‘symptoms in these patients appear to be similar to those of seasonal influenza.’ For those bothering to read through three detailed pages of the CDC New York report, they found near the end that, ‘on April 27, 37 patients (84%) reported that their symptoms were stable or improving, three (7%) reported worsening symptoms (two of whom later reported improvement), and four (9%) reported complete resolution of symptoms. Only one reported having been hospitalized for syncope and released after overnight observation.’ The CDC adds, ‘To date, this school-based outbreak is the largest cluster of S-OIV cases reported in the United States.’ 4

In addition to the 109 ‘confirmed cases’ reported in the United States, including one death of a Mexican boy in Texas, the CDC reported as of April 29, ‘a total of 57 confirmed cases had been reported, including seven deaths (in Mexico). By country, the following numbers of cases had been reported: Mexico (26); Canada (13); United Kingdom (five); Spain (four); Germany and New Zealand (three each); Israel (two); and Austria (one).’5 Is this another case of ‘Chicken Little’ crying the sky is falling?

A revealing name change


Now, not only are the alleged victims in New York of the worst plague since the Black Death showing signs of remarkable recovery after only days, but the WHO also announces a name change in the middle of the worldwide events. By May 1 the WHO, the CDC and the National Institutes of Health in Maryland all announced the name Swine Flu was no longer appropriate, that, despite the fact that according to Dr. Raul Rabadan, a professor of computational biology at Columbia University, six of the eight genetic segments are purely swine flu and the other two segments are bird and human, but have lived in swine for the past decade.6

We instead are told to call it Influenza A (H1N1). That’s a catchy name.

 

The name change came following a heavy lobbying campaign by the US pig industry to drop the Swine Flu label as it was apparently cutting into pork sales. The largest US and world pig producer, Smithfield Foods of Virginia, was most certainly among those lobbying CDC and the WHO for the name change. They won their wish. But name change or not, the swine production process of Smithfield Foods and other industrialized Factory Farms or as they are technically known, CAFOs—Concentrated Animal Feeding Operation—bears closer scrutiny.

 

As I detailed in Part I, the Mexican Swine Flu deaths and illness first were recorded in La Gloria, Perote Municipality, Veracruz State, Mexico, where local residents had for weeks prior to the official announcement been protesting the dangers of the huge Smithfield Foods pig CAFO in the village. Children and adults alike were reported having a rash of symptoms in the vicinity of the vast pig waste linked to the site. Smithfield Foods is the world’s largest industrialized pig meat producer. It also has one of the most egregious health and safety records.

 

Pig feces and other niceties

 

Feces is the Latin term for what most of the world terms shit, the waste product of human or animal digestion. Pigs are world champion waste producers. An average pig produces some three times in weight the amount of fecal matter that an adult person does. As GRAIN, an agricultural organization reports, ‘the rise of large-scale factory farms in North America has created the perfect breeding grounds for the emergence and spread of new highly-virulent strains of influenza.’7 The pig fecal waste product is at the center of the problem, something the CDC name change conveniently tends to obscure.

 

As the GRAIN study notes, because concentrated animal feeding operations tend to concentrate large numbers of animals close together, they are ideal breeding grounds for toxins and virulent pathogens. In 2003 Science magazine warned that swine flu was ‘on a new evolutionary ‘fast track’ due to the increasing size of factory farms and the widespread use of vaccines in these operations.’8 It’s the same story with bird flu, where huge industrial CAFO Factory Farms with tens of thousands of chickens breed toxic waste galore.

 

Smithfield Foods, the world’s biggest hog butcher and CAFO owner has an impressive track record of violations of health and safety including water safety laws. In the USA, the world’s largest pig CAFO is in Tar Heel, North Carolina. According to local reports the town could easily be renamed Pig Waste, N.C. given the scale of fecal waste and combined matter Smithfield Foods’ Tar Heel CAFO emits locally.

 

As Jeff Tietz, in an analysis of the pig waste problem calculated, ‘the best estimates put Smithfield's total waste discharge at 26 million tons a year. That would fill four Yankee Stadiums. Even when divided among the many small pig production units that surround the company's slaughterhouses, that is not a containable amount.’9

 

Tietz adds, ‘So prodigious is its fecal waste, however, that if the company treated its effluvia as big-city governments do -- even if it came marginally close to that standard -- it would lose money. So many of its contractors allow great volumes of waste to run out of their slope-floored barns and sit blithely in the open, untreated, where the elements break it down and gravity pulls it into groundwater and river systems. Although the company proclaims a culture of environmental responsibility, ostentatious pollution is a linchpin of Smithfield's business model.’10

 

The problem, he and other critics of CAFO pollutants stress, is not just normal pig waste, but waste combined with staggering volumes of antibiotics and toxic chemicals used by Smithfield Foods and similar industrial CAFO operations to maximize ‘efficiency.’

 

Tietz notes, ‘A lot of pig shit is one thing; a lot of highly toxic pig shit is another. The excrement of Smithfield hogs is hardly even pig shit: On a continuum of pollutants, it is probably closer to radioactive waste than to organic manure. The reason it is so toxic is Smithfield's efficiency. The company produces 6 billion pounds of packaged pork each year. That's a remarkable achievement, a prolificacy unimagined only two decades ago, and the only way to do it is to raise pigs in astonishing, unprecedented concentrations.’11





The degrees of concentration in the Smithfield Foods vertically integrated pig meat concentrations have little to do with traditional hog farming. In facilities now spread around the world, Smithfield's pigs live by the hundreds or thousands in warehouse-like barns, in rows of wall-to-wall pens. Sows are artificially inseminated and fed and delivered of their piglets in cages so small they cannot turn around.

 

As Tietz notes, ‘Forty fully grown 250-pound male hogs often occupy a pen the size of a tiny apartment. They trample each other to death. There is no sunlight, straw, fresh air or earth. The floors are slatted to allow excrement to fall into a catchment pit under the pens, but many things besides excrement can wind up in the pits: afterbirths, piglets accidentally crushed by their mothers, old batteries, broken bottles of insecticide, antibiotic syringes, stillborn pigs -- anything small enough to fit through the foot-wide pipes that drain the pits. The pipes remain closed until enough sewage accumulates in the pits to create good expulsion pressure; then the pipes are opened and everything bursts out into a large holding pond.’12

 

He continues on the toxic CAFO conditions: ‘They become susceptible to infection, and in such dense quarters microbes or parasites or fungi, once established in one pig, will rush sprite-like through the whole population. Accordingly, factory pigs are infused with a huge range of antibiotics and vaccines, and are doused with insecticides. Without these compounds -- oxytetracycline, draxxin, ceftiofur, tiamulin -- diseases would likely kill them. Thus factory-farm pigs remain in a state of dying until they're slaughtered. When a pig nearly ready to be slaughtered grows ill, workers sometimes shoot it up with as many drugs as necessary to get it to the slaughterhouse under its own power. As long as the pig remains ambulatory, it can be legally killed and sold as meat.’ 13

 

Jeff Tietz is not the only one who has noticed the gargantuan scale of the Smithfield Foods CAFO pig waste problem. The United States Government Environmental Protection Agency, EPA, has repeatedly fined Smithfield Foods for damage to local water supply with discharge of its pig waste from its CAFOs at Tar Heel and elsewhere across the USA. In Virginia, its home state, Smithfield was fined $12.6 million in 1997 for 6,900 violations of the Clean Water Act -- the third-largest civil penalty ever levied under the act by the EPA, for waste generated during the hog-slaughtering and meat processing operations.14 There was little convincing evidence the fines changed their practice of waste disposal in any significant way.

 

Smithfield Foods has spread its hog CAFOs to other countries where environmental regulations are presumably less strict, including Romania, Poland, and of course, rural Mexico. Several years ago the Smithfield pig CAFO in Romania was focus of major accusations by local and Government health officials. Smithfield refused to let local authorities enter its pig farms after residents complained of the stench coming from hundreds of dead corpses of pigs left rotting for days at the farms. ‘Our doctors have not had access to the American [company's] farms to effect routine inspections,’ stated Csaba Daroczi, assistant director at the Timisoara Hygiene and Veterinary Authority in Romania. ‘Every time they tried, they were pushed away by the guards. Smithfield proposed that we sign an agreement that would oblige us to warn them three days before each inspection.’ It later emerged that Smithfield had been covering up a major outbreak of classical swine fever on its Romanian CAFO farms.15

 

The Drug Cartel comes in

 

Rather than order a full-scale independent investigation into the pathogen-generation in the toxic waste of Smithfield Foods’ Veracruz CAFO pig operations or other similar pig CAFOs around the world for production of deadly toxics and various possible pathogens, the CDC and increasingly the WHO seem to be more concerned with creating a climate for mass distribution of what have been documented to be dangerous, and in some cases deadly, influenza drugs such as Tamiflu.

 

On April 14, almost two weeks before the panic over Mexico’s cases of Swine Flu or as CDC now prefers, Influenza A H1N1, the US pharmaceutical company, Novavax announced a pre-clinical study allegedly showing, ‘an investigational H1N1 virus-like particle (VLP) vaccine based on the 1918 Spanish influenza strain protected against both the Spanish flu and a highly pathogenic H5N1 avian influenza strain.’ The genetically-manipulated vaccine of Novavax, the company claimed, ‘protected Mice and Ferrets Against the Spanish Flu and Highly Pathogenic H5N1 Bird Flu,’ and also conveniently ‘provided protection against highly pathogenic H1N1 and H5N1 Influenza strains.’16

 

On April 24, the WHO issued a press release stating that ‘The Swine Influenza A/H1N1 viruses characterized in this outbreak have not been previously detected in pigs or humans. The viruses so far characterized have been sensitive to oseltamivir…’ Osteltamivir is the technical name for Tamiflu, the drug invented by Donald Rumsfeld’s Gilead Sciences and licensed to Roche Inc. The US Food and Drug Administration (FDA) issued a convenient Emergency Authorization on April 27 that allows US health officials and others to administer Tamiflu even to infants under one year of age. The FDA statement added it had decided, ‘to authorize the use of unapproved or uncleared medical products or unapproved or uncleared uses of approved or cleared medical products following a determination and declaration of emergency.’17

 

That suggests that the US Government has or is about to release experimental drugs on a panicked population such as the VLP-based Influenza vaccine of Novavax, as well as the vast stockpiles of Tamiflu and  influenza drugs sold by giants like GlaxoSmithKline’s Relenza (zanamivir).

 

With the evidence to date of the scale of the ‘confirmed’ cases of Swine Flu H1N1 variety worldwide, 985 cases of influenza A (H1N1) or Swine Flu infection, there is hardly grounds to subject the human population to drugs whose side effects have included death or severe complications and typically flu-like symptoms and, as in the case of Tamiflu, never even claim to ‘prevent or cure’ the influenza. The entire drama of the past weeks is reading more and more like a bad remake of Crichton’s Andromeda Strain.

 

Adding a note of the bizarre to the entire drama, in November 2004, amid the early days of the then-world panic over alleged Avian Flu, when Tamiflu was first promoted as a wonder drug by Donald Rumsfeld and others, the WHO published an extraordinary fantasy scenario. In a UN agency normally given to issuing dull scientific notices to world health professionals, the 2004 report was extraordinarily ‘prescient’ of the current scenario with Swine Flu panic. In a fantasy section titled ‘Sometime in the future…’ the WHO wrote four years ago,

 

 Rumours of an outbreak of unusually severe respiratory illness in two vil-

lages in a remote province reach the ministry of health in one of the World

Health Organization’s (WHO’s) Member States. A team is dispatched to

the province and learns that the outbreak started about a month earlier.

The team is able to identify at least 50 cases over the previous month. All

age groups have been affected. Twenty patients are currently in the pro-

vincial hospital. Five people have already died of pneumonia and acute

respiratory failure. Surveillance in surrounding areas is increased, and new

cases are identified throughout the province. Respiratory specimens col-

lected from several patients are tested at the national laboratory and are

found to be positive for type A influenza virus, but they cannot be further

subtyped. The isolates are sent to the WHO Reference Centre for Influ-

enza for further characterization, where they are characterized as influ-

enza A(H6N1), a subtype never isolated from humans before. Gene

sequencing studies further indicate that most of the viral genes are from a

bird influenza virus, with the remaining genes derived from a human strain.18

 

If one changed the name from Influenza A (H6N1) to Influenza A (H1N1) we could be talking about the current situation.

 

That 2004 WHO fictional scenario reads as if it were the handbook for what has unfolded since late April in the US Mexico and beyond. It leads to serious question whether the world is being submitted to a giant psychological warfare game aimed at inducing them to take massive doses of dangerous drugs to counter a danger that does not actually exist as claimed.

 

With the reported cases in Mexico clearly dropping off at present and little sign of the feared repeat of the 1918 Spanish Flu or worse as officials were warning only days earlier, it is well beyond time to launch a full-scale worldwide health inquiry into the toxic conditions of CAFO pig and other animal Factory Farm concentrations, and to end the official coverup of what has become a colossal health danger.   

 


F. William Engdahl is author of Seeds of Destruction: The Hidden Agenda of Genetic Manipulation (www.globalresearch.ca), and A Century of War: Anglo-American Oil Politics and the New World Order (Pluto Press). His latest book, Full Spectrum Dominance: Totalitarian Democracy in the New World Order (Third Millennium Press), is due to be released later this month. He may be reached via his website, www.engdahl.oilgeopolitics.net.

 



Notes:



1 Centers for Disease Control, Swine-Origin Influenza A (H1N1) Virus Infections in a School --- New York City, April 2009, April 30, 2009. Accessed in
http://www.cdc.gov/mmwr/preview/mmwrhtml/mm58d0430a1.htm.

2 Margaret Chan, WHO Director-General, quoted in Murray Wardrop, Swine flu All of humanity under threat WHO warns, Daily Telegraph, London, April 30, 2009.

3 CDC, H1N1 (Swine Flu), accessed in http://www.cdc.gov/h1n1flu/.

4Centers for Disease Control, Swine-Origin Influenza A (H1N1) Virus Infections in a School --- New York City… Op. Cit.

5  Ibid.

6  Seth Borenstein, Swine flu name change? Flu genes spell pig, AP, May 1, 2009, accessed in
http://www.physorg.com/news160371024.html.

7 GRAIN, A food system that kills: Swine flu is meat industry’s latest plague, April 2009, accessed in
http://www.grain.org/articles/?id=48.

8  Bernice Wuethrich, Chasing the Fickle Swine Flu, Science, Vol. 299, 2003.

9 Jeff Tietz, Pork’s Dirty Secret: America’s Top Hog Producer is also one of America’s Worst Polluters, Rolling Stone, December 14, 2006.

10 Ibid.

11 Ibid.

12 Ibid.

13 Ibid.

14 EPA, UNITED STATES SUES SMITHFIELD FOODS FOR POLLUTING VIRGINIA WATERWAYS, Press Release, December 16, 1996.

15 Mirel Bran, Swine Plague: Romania Criticizes American Group’s Attitude, Le Monde, 15 August
2007, translated by Leslie Thatcher, cited in GRAIN Op Cit..

16 Tricia J. Richardson, NOVAVAX Announces Publication of a Preclinical Study Demonstrating that a Virus-like Particle Vaccine Provided Protection Against Highly Pathogenic H1N1 and H5N1 Influenza Strains, April 14, 2009, Rockville, Md. Press Release.

17 FDA News, FDA Authorizes Emergency Use of Influenza Medicines, Diagnostic Test in Response to Swine Flu Outbreak in Humans, April 27, 2009.

18 WHO,  WHO checklist for influenza pandemic preparedness planning, November 2004, accessed in
http://209.85.129.132/search?q=cache:XuupgF1uNAIJ:www.who.int/csr/resources/publications/influenza/FluCheck6web.pdf+who+influenza+pandemic+preparedness+checklist&cd=1&hl=de&ct=clnk&gl=de&client=firefox-a.

 
 
Logged
TahoeBlue
Global Moderator
Member
*****
Online Online

Posts: 7,401


« Reply #1748 on: May 12, 2009, 10:08:58 PM »

From DrudgeReport:

http://www.bloomberg.com/apps/news?pid=20601087&sid=afrdATVXPEAk&refer=worldwide

Swine Flu May Be Human Error; WHO Probes Scientist’s Claim

By Jason Gale and Simeon Bennett

May 13 (Bloomberg) -- The World Health Organization is investigating a claim by an Australian researcher that the swine flu virus circling the globe may have been created as a result of human error.

Adrian Gibbs, 75, who collaborated on research that led to the development of Roche Holding AG’s Tamiflu drug, said in an interview that he intends to publish a report suggesting the new strain may have accidentally evolved in eggs scientists use to grow viruses and drugmakers use to make vaccines. Gibbs said he came to his conclusion as part of an effort to trace the virus’s origins by analyzing its genetic blueprint.

The World Health Organization received the study last weekend and is reviewing it, Keiji Fukuda, the agency’s assistant director-general of health security and environment, said in an interview May 11. Gibbs, who has studied germ evolution for four decades, is one of the first scientists to analyze the genetic makeup of the virus that was identified three weeks ago in Mexico and threatens to touch off the first flu pandemic since 1968.

A virus that resulted from lab experimentation or vaccine production may indicate a greater need for security, Fukuda said. By pinpointing the source of the virus, scientists also may better understand the microbe’s potential for spreading and causing illness, Gibbs said.

Possible Mistake

“The sooner we get to grips with where it’s come from, the safer things might become,” Gibbs said by phone from Canberra yesterday. “It could be a mistake” that occurred at a vaccine production facility or the virus could have jumped from a pig to another mammal or a bird before reaching humans, he said.

Gibbs and two colleagues analyzed the publicly available sequences of hundreds of amino acids coded by each of the flu virus’s eight genes. He said he aims to submit his three-page paper today for publication in a medical journal.

“You really want a very sober assessment” of the science behind the claim, Fukuda said May 11 at the WHO’s Geneva headquarters.

The U.S. Centers for Disease Control and Prevention in Atlanta has received the report and has decided there is no evidence to support Gibbs’s conclusion, said Nancy Cox, director of the agency’s influenza division. She said since researchers don’t have samples of swine flu viruses from South America and Africa, where the new strain may have evolved, those regions can’t be ruled out as natural sources for the new flu.

No Evidence

“We are interested in the origins of this new influenza virus,” Cox said. “But contrary to what the author has found, when we do the comparisons that are most relevant, there is no evidence that this virus was derived by passage in eggs.”

The WHO’s collaborative influenza research centers, which includes the CDC, and sites in Memphis, Melbourne, London and Tokyo, were asked by the international health agency to review the study over the weekend, Fukuda said. The request was extended to scientists at the Food and Agriculture Organization in Rome, the World Organization for Animal Health in Paris, as well as the WHO’s influenza network, he said.

“My guess is that the picture should be a lot clearer over the next few days,” Fukuda said. “We have asked a lot of people to look at this.”

Lab Escape

Gibbs wrote or co-authored more than 250 scientific publications on viruses during his 39-year career at the Australian National University in Canberra, according to biographical information on the university’s Web site.

Swine flu has infected 5,251 people in 30 countries so far, killing 61, according to the WHO. Scientists are trying to determine whether the virus will mutate and become more deadly if it spreads to the Southern Hemisphere and back. Flu pandemics occur when a strain of the disease to which few people have immunity evolves and spreads.

Gibbs said his analysis supports research by scientists including Richard Webby, a virologist at St. Jude Children’s Research Hospital in Memphis, who found the new strain is the product of two distinct lineages of influenza that have circulated among swine in North America and Europe for more than a decade.

In addition, his research found the rate of genetic mutation in the new virus outpaced that of the most closely related viruses found in pigs, suggesting it evolved outside of swine, Gibbs said.

Some scientists have speculated that the 1977 Russian flu, the most recent global outbreak, began when a virus escaped from a laboratory.

Other Theories?

Identifying the source of new flu viruses is difficult without finding the exact strain in an animal or bird “reservoir,” said Jennifer McKimm-Breschkin, a virologist at the Commonwealth Science and Industrial Research Organization in Melbourne.

“If you can’t find an exact match, the best you can do is compare sequences,” she said. “Similarities may give an indication of a possible source, but this remains theoretical.”

The World Organization for Animal Health, which represents chief veterinary officers from 174 countries, received the Gibbs paper and is working with the WHO on an assessment, said Maria Zampaglione, a spokeswoman.

The WHO wants to know whether any evidence that the virus may have been developed in a laboratory can be corroborated and whether there are other explanations for its particular genetic patterns, according to Fukuda.

‘Wild Idea’

“These things have to be dealt with straight on,” he said. “If someone makes a hypothesis, then you test it and you let scientific process take its course.”

Gibbs said he has no evidence that the swine-derived virus was a deliberate, man-made product.

“I don’t think it could be a malignant thing,” he said. “It’s much more likely that some random thing has put these two viruses together.”

Gibbs, who spent most of his academic career studying plant viruses, said his major contribution to the study of influenza occurred in 1975, while collaborating with scientists Graeme Laver and Robert Webster in research that led to the development of the anti-flu medicines Tamiflu and Relenza, made by GlaxoSmithKline Plc.

“We were out on one of the Barrier Reef islands, off Australia, catching birds for the flu in them, and I happened to be the guy who caught the best,” Gibbs said. The bird he got “yielded the poo from which was isolated the influenza isolate strain from which all the work on Tamiflu and Relenza started.”

Gibbs, who says he studies the evolution of flu viruses as a “retirement hobby,” expects his research to be challenged by other scientists.

“This is how science progresses,” he said. “Somebody comes up with a wild idea, and then they all pounce on it and kick you to death, and then you start off on another silly idea.”

To contact the reporters on this story: Jason Gale in Geneva at j.gale@bloomberg.net; Simeon Bennett in Singapore at sbennett9@bloomberg.net.

Last Updated: May 12, 2009 21:16 EDT
Logged
rh
Member
*
Offline Offline

Posts: 9



« Reply #1749 on: May 14, 2009, 04:04:20 PM »


 Check out the release date: May 11

http://www.apple.com/trailers/fox_atomic/28weekslater/
Logged
Unintelligable Name
Member
*****
Offline Offline

Posts: 8,651


« Reply #1750 on: May 14, 2009, 05:06:12 PM »

So far the CDC document where they took 1918 flu and mixed it with Avian flu [may be mistaken there, only read the report once] then injected it into pigs.... is what has me leaning toward bioweapon.

What is needed for me to say "100%" is if this Swine Flu [or the variant released in the fall/winter] contains the 1918 genes that made it deadly. I would tend to think from the lack of deaths in the United States [that we are told, the real number is unknowable to people like us] that it is not a very deadly bioweapon, but a dud [if it is weaponized at all]

Time will tell, as always.
Logged
sociostudent
Guest
« Reply #1751 on: May 15, 2009, 10:25:28 AM »

the PB1-F2 gene is non-functioning, that's why it's not superdeadly.

http://www.ncbi.nlm.nih.gov/genomes/FLU/SwineFlu.html

http://virology.disqus.com/influenza_amexico2009_h1n1_absence_of_crucial_virulence_marker/


Logged
Unintelligable Name
Member
*****
Offline Offline

Posts: 8,651


« Reply #1752 on: May 15, 2009, 01:04:44 PM »

I think they used RNA interference to create a "dummy virus" so to speak (that had the PB1-F2 gene "turned off" so that this would be the initiator for both the "WHO b.s. pandemic level 6 martial law/forced inoculations/etc" and the vaccine sales, which are going to make a few people a LOT of money (on top of the Tamiflu and Relenza sales) WITHOUT actually killing a lot of people. (At least not yet, anyway, you never know with these psychos).
Here's how they could do it:
http://www.iom.edu/Object.File/Master/21/632/0.pdf
http://www.informapharmascience.com/doi/abs/10.1080/10611860802473048
"February 2009, Vol. 17, No. 2, Pages 133-139 , ...In the present study, we designed small interfering RNA (siRNA) targeting overlapping gene of PB1 and PB1-F2 gene of the influenza A virus and investigated its effect against influenza A virus infection. A reduction in virus-associated cell apoptosis was observed in A549 cells treated with this siRNA.

From what we've seen so far, this thing looks like it's TRIED to mutate itself out, but keeps showing up in random areas. But only in a few key areas has the non-functioning PB1-F2 segment even shown up (only the sequences on the pubmed page listed under "PB1" even HAVE it).

http://www.ncbi.nlm.nih.gov/genomes/FLU/SwineFlu.html

I don't know if the isolates without the PB1-F2 segment are derived from the original outbreak or not, but seeing as how it keeps re-emerging in this atypical pattern, it seems kind of silly to assume so.
 

(P.S.--Are the sequences working for ya'll anymore? they won't pull up for me)  Angry









Logged
Unintelligable Name
Member
*****
Offline Offline

Posts: 8,651


« Reply #1753 on: May 15, 2009, 01:07:49 PM »

Quote
Third, the H1N1 subtype comprises 3 genetic lineages. One clade has 2 branches: 1 branch includes the human viruses, with the pandemic 1918 virus at its root; the other branch includes the classic swine viruses. The third clade represents the European porcine isolates. Although all classic swine sequences have a truncated PB1-F2 (in-frame stop codons after 11, 24, and 35 codons), the early human isolates (H1N1 sequences from 1918 through 1947) have an intact PB1-F2

Confusing article... it's referring to H1N1 as many different strains, or so it appears!

Quote
Because PB1-F2 was described as a proapoptotic protein probably counteracting the host immune response, why numerous human and porcine isolates lack this protein without selective disadvantage remains unclear

Quote
Human H1N1 from 1918 through 1947 contains full-length PB1-F2, whereas human H1N1 beginning in 1956 has a truncated PB1-F2 after codon 57

No it definately is talking about seperate strains using the same H1N1 designation.

Quote
We speculate that the expression of a full-length PB1-F2 may contribute to disease severity in humans. [2006]

Quote
The current swine virus lacks an important molecular signature (the protein PB1-F2) which was present in the 1918 virus and in the highly lethal H5N1 chicken viruses
Logged
netizen_x
Member
*****
Offline Offline

Posts: 1,733


When Spider webs unite, they can tie up a lion


WWW
« Reply #1754 on: May 15, 2009, 07:34:09 PM »

Confusing article... it's referring to H1N1 as many different strains, or so it appears!

No it definately is talking about seperate strains using the same H1N1 designation.

That's why I believe a lot of this information is mumbo jumbo just like when a witch doctor jumps up and down hysterically blabbering incoherently then writhes around on the ground frothing at the mouth like Tony Blair. The customers assume the witch doctor actually knows what he is doing and is actually speaking an esoteric spiritual language only understood by initiates when in fact, it's all just a show.

How about this scenario: It's just a normal old flu virus that's being over-analyzed by too many over-educated young brats aspiring to a scientific career. The initial deaths were caused by an overzealous young intern who over-medicated a patient.

So far, it appears the few deaths recorded in the US were in people who had serious underlying respiratory conditions that were already killing them.

"the answer my friend is blowing in the wind, the answer is blowing in the wind" ~Bob Dylan.
Logged

"Since corrupt people unite amongst themselves to constitute a force, then honest people must do the same" ~ Leo Tolstoy
TahoeBlue
Global Moderator
Member
*****
Online Online

Posts: 7,401


« Reply #1755 on: May 15, 2009, 08:33:46 PM »

...
How about this scenario: It's just a normal old flu virus that's being over-analyzed by too many over-educated young brats aspiring to a scientific career. The initial deaths were caused by an overzealous young intern who over-medicated a patient.

So far, it appears the few deaths recorded in the US were in people who had serious underlying respiratory conditions that were already killing them.
.

If it helps you sleep nights.  Shocked
Logged
Irobot
Member
*****
Offline Offline

Posts: 3,215


SHOW HOST WANTED!


WWW
« Reply #1756 on: May 15, 2009, 09:11:47 PM »

May 15, 2009 -- More than 100,000 Americans probably have the flu -- and at least half of these cases are H1N1 swine flu, a CDC expert estimates.

Jernigan noted that the 4,700 confirmed or probable cases of swine flu reported to CDC represent a gross underestimate. When asked how many actual cases there were, Jernigan noted that 7% to 10% of the U.S. population -- up to 30 million people -- get the seasonal flu each year.

"So with the amount of activity we are seeing now, it is a little hard to know what that means in terms of making an estimate now of the total number of people with flu out in the community," Jernigan said. "But if I had to make an estimate, I would say ... probably upwards of maybe 100,000."

The CDC's most recent data, for the week ending May 9, shows that about half of Americans with confirmed flu had the H1N1 swine flu. If Jernigan's off-the-cuff estimate is correct, more than 50,000 people in the U.S. have the new flu.

At a time when flu season should be ending or over, the CDC's flu season indicators are going up instead of down. As of May 9, 22 states had widespread or regional flu.

Meanwhile, Arizona's Maricopa County -- home to Phoenix -- reported that a woman in her late 40s died from complications of the H1N1 swine flu. She is the nation's fourth H1N1 swine flu fatality. The woman had an underlying lung disease, according to the Maricopa County public health department.

Despite the death, the CDC's marker for flu severity -- deaths from pneumonia or flu -- did not increase beyond normal levels for this time of year. This so-called "epidemic threshold" is 7.4% of all deaths; for the week ending May 9, flu/pneumonia deaths were 7.2% of all deaths.

One of the most alarming signs of a flu pandemic is a lot of severe illness in people who don't usually suffer severe flu cases -- older children and young adults.

Most of the 173 people hospitalized in the U.S. with H1N1 swine flu have been between 5-24 years old.

"At this point, we're not seeing the seriousness of illness in the United States that was initially reported in Mexico, but this certainly does not mean that the outbreak is over," Jernigan said. "The H1N1 virus is not going away. We know that the outbreak is not localized but is spreading and appears to be expanding throughout
Logged

12160  "Destroying the NWO"
Check out the blogs, videos, and discussions!!
http://12160.info/

RADIO HOST WANTED!!! 
Trolls R People 2
Unintelligable Name
Member
*****
Offline Offline

Posts: 8,651


« Reply #1757 on: May 15, 2009, 09:40:14 PM »

That's why I believe a lot of this information is mumbo jumbo just like when a witch doctor jumps up and down hysterically blabbering incoherently then writhes around on the ground frothing at the mouth like Tony Blair.

Actually it's just the nomenclature that I was unfamiliar with. Influenza A virus subtype H1N1 refers to a type of Influenza which has seperate strains within that subtype. Not exactly the best way of doing things but for whatever reason it's how they choose to do it.
Logged
netizen_x
Member
*****
Offline Offline

Posts: 1,733


When Spider webs unite, they can tie up a lion


WWW
« Reply #1758 on: May 16, 2009, 07:07:50 PM »

I like how human flu has gene sequence A B C D, swine flu has A B C E, bird flu has A B C F then the media reports "OH MY GOD IT HAS ELEMENTS OF HUMAN FLU, BIRD FLU AND SWINE FLU!!!!

By using this logic, your mother has elements of reptilian and primate genes OH MY GOD!

If 50 000 people in the US have swine flu as reported above, then it's not swine flu at all, it's just a normal human flu with a new fancy name to scare the sh!t out of you.

This is all about branding, they are using language to manipulate us as usual.   
Logged

"Since corrupt people unite amongst themselves to constitute a force, then honest people must do the same" ~ Leo Tolstoy
Aerioch
Member
*****
Offline Offline

Posts: 2,332



« Reply #1759 on: May 17, 2009, 02:06:23 PM »

Strange is it not that the W.H.O. scares the shit out of the world by jumping from a "No Threat" status to "Potential Pandemic" levels within a two-week period... then goes almost silent.

They just needed enough press to justify every industrial nation to buy tamiflu anti-virals, and get in line for the vaccine about to be mass-produced, and shipped worldwide.
Logged

Dr. Strangelove: Or, How I Learned to Stop Worrying and Love the Bomb
Pages: 1 ... 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 [44] 45 46 47   Go Up
  Print  
 
Jump to:  

Powered by MySQL Powered by PHP Powered by SMF 1.1.17 | SMF © 2011, Simple Machines Valid XHTML 1.0! Valid CSS!